Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4084481..4085100 Replicon chromosome
Accession NZ_CP114375
Organism Klebsiella pneumoniae strain KP6870155

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NOZ09_RS20345 Protein ID WP_002892050.1
Coordinates 4084882..4085100 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NOZ09_RS20340 Protein ID WP_002892066.1
Coordinates 4084481..4084855 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NOZ09_RS20330 (4079633) 4079633..4080826 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NOZ09_RS20335 (4080849) 4080849..4083995 + 3147 WP_004147373.1 multidrug efflux RND transporter permease subunit AcrB -
NOZ09_RS20340 (4084481) 4084481..4084855 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NOZ09_RS20345 (4084882) 4084882..4085100 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NOZ09_RS20350 (4085259) 4085259..4085825 + 567 WP_087842734.1 maltose O-acetyltransferase -
NOZ09_RS20355 (4085797) 4085797..4085937 - 141 WP_004147370.1 hypothetical protein -
NOZ09_RS20360 (4085958) 4085958..4086428 + 471 WP_002892026.1 YlaC family protein -
NOZ09_RS20365 (4086403) 4086403..4087854 - 1452 WP_038989586.1 PLP-dependent aminotransferase family protein -
NOZ09_RS20370 (4087955) 4087955..4088653 + 699 WP_032434109.1 GNAT family protein -
NOZ09_RS20375 (4088650) 4088650..4088790 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NOZ09_RS20380 (4088790) 4088790..4089053 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T266649 WP_002892050.1 NZ_CP114375:4084882-4085100 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT266649 WP_002892066.1 NZ_CP114375:4084481-4084855 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References