Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4084481..4085100 | Replicon | chromosome |
| Accession | NZ_CP114375 | ||
| Organism | Klebsiella pneumoniae strain KP6870155 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | NOZ09_RS20345 | Protein ID | WP_002892050.1 |
| Coordinates | 4084882..4085100 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | NOZ09_RS20340 | Protein ID | WP_002892066.1 |
| Coordinates | 4084481..4084855 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NOZ09_RS20330 (4079633) | 4079633..4080826 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NOZ09_RS20335 (4080849) | 4080849..4083995 | + | 3147 | WP_004147373.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| NOZ09_RS20340 (4084481) | 4084481..4084855 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| NOZ09_RS20345 (4084882) | 4084882..4085100 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| NOZ09_RS20350 (4085259) | 4085259..4085825 | + | 567 | WP_087842734.1 | maltose O-acetyltransferase | - |
| NOZ09_RS20355 (4085797) | 4085797..4085937 | - | 141 | WP_004147370.1 | hypothetical protein | - |
| NOZ09_RS20360 (4085958) | 4085958..4086428 | + | 471 | WP_002892026.1 | YlaC family protein | - |
| NOZ09_RS20365 (4086403) | 4086403..4087854 | - | 1452 | WP_038989586.1 | PLP-dependent aminotransferase family protein | - |
| NOZ09_RS20370 (4087955) | 4087955..4088653 | + | 699 | WP_032434109.1 | GNAT family protein | - |
| NOZ09_RS20375 (4088650) | 4088650..4088790 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| NOZ09_RS20380 (4088790) | 4088790..4089053 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T266649 WP_002892050.1 NZ_CP114375:4084882-4085100 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT266649 WP_002892066.1 NZ_CP114375:4084481-4084855 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |