Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 814966..815623 | Replicon | chromosome |
Accession | NZ_CP114375 | ||
Organism | Klebsiella pneumoniae strain KP6870155 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | W8UCT0 |
Locus tag | NOZ09_RS04050 | Protein ID | WP_002916310.1 |
Coordinates | 815213..815623 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | NOZ09_RS04045 | Protein ID | WP_002916312.1 |
Coordinates | 814966..815232 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NOZ09_RS04020 (810122) | 810122..811555 | - | 1434 | WP_002916322.1 | 6-phospho-beta-glucosidase BglA | - |
NOZ09_RS04025 (811674) | 811674..812402 | - | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
NOZ09_RS04030 (812452) | 812452..812763 | + | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
NOZ09_RS04035 (812927) | 812927..813586 | + | 660 | WP_002916317.1 | hemolysin III family protein | - |
NOZ09_RS04040 (813737) | 813737..814720 | - | 984 | WP_002916313.1 | tRNA-modifying protein YgfZ | - |
NOZ09_RS04045 (814966) | 814966..815232 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
NOZ09_RS04050 (815213) | 815213..815623 | + | 411 | WP_002916310.1 | protein YgfX | Toxin |
NOZ09_RS04055 (815630) | 815630..816151 | - | 522 | WP_004144730.1 | flavodoxin FldB | - |
NOZ09_RS04060 (816252) | 816252..817148 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
NOZ09_RS04065 (817171) | 817171..817884 | + | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NOZ09_RS04070 (817890) | 817890..819623 | + | 1734 | WP_032105216.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T266643 WP_002916310.1 NZ_CP114375:815213-815623 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GSW7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |