Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 4589666..4590252 | Replicon | chromosome |
Accession | NZ_CP114374 | ||
Organism | Pseudomonas aeruginosa strain Jade-X |
Toxin (Protein)
Gene name | PumA | Uniprot ID | G8CP73 |
Locus tag | O2604_RS21570 | Protein ID | WP_003120987.1 |
Coordinates | 4589953..4590252 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | O2604_RS21565 | Protein ID | WP_003448662.1 |
Coordinates | 4589666..4589956 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O2604_RS21545 (O2604_21545) | 4585242..4587137 | + | 1896 | WP_269315082.1 | hypothetical protein | - |
O2604_RS21550 (O2604_21550) | 4587134..4589110 | + | 1977 | WP_180705078.1 | DEAD/DEAH box helicase | - |
O2604_RS21555 (O2604_21555) | 4589120..4589254 | + | 135 | WP_259467026.1 | hypothetical protein | - |
O2604_RS21560 (O2604_21560) | 4589251..4589595 | + | 345 | WP_003448665.1 | hypothetical protein | - |
O2604_RS21565 (O2604_21565) | 4589666..4589956 | - | 291 | WP_003448662.1 | putative addiction module antidote protein | Antitoxin |
O2604_RS21570 (O2604_21570) | 4589953..4590252 | - | 300 | WP_003120987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
O2604_RS21575 (O2604_21575) | 4590454..4591575 | + | 1122 | WP_021205778.1 | TcpQ domain-containing protein | - |
O2604_RS21580 (O2604_21580) | 4591575..4593284 | + | 1710 | WP_180705079.1 | PilN family type IVB pilus formation outer membrane protein | - |
O2604_RS21585 (O2604_21585) | 4593288..4594613 | + | 1326 | WP_180705080.1 | type 4b pilus protein PilO2 | - |
O2604_RS21590 (O2604_21590) | 4594603..4595136 | + | 534 | WP_059303264.1 | type IV pilus biogenesis protein PilP | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11133.88 Da Isoelectric Point: 10.4495
>T266637 WP_003120987.1 NZ_CP114374:c4590252-4589953 [Pseudomonas aeruginosa]
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|