Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
| Location | 143721..144226 | Replicon | chromosome |
| Accession | NZ_CP114374 | ||
| Organism | Pseudomonas aeruginosa strain Jade-X | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | V6A7K8 |
| Locus tag | O2604_RS00660 | Protein ID | WP_003083773.1 |
| Coordinates | 143721..144002 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A1C7BDS9 |
| Locus tag | O2604_RS00665 | Protein ID | WP_003083775.1 |
| Coordinates | 143999..144226 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O2604_RS00635 (O2604_00635) | 138972..140321 | + | 1350 | WP_003119513.1 | C4-dicarboxylate transporter DctA | - |
| O2604_RS00640 (O2604_00640) | 140370..141056 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
| O2604_RS00645 (O2604_00645) | 141157..141891 | + | 735 | WP_003117208.1 | GntR family transcriptional regulator | - |
| O2604_RS00650 (O2604_00650) | 142071..142481 | + | 411 | WP_033937009.1 | aegerolysin family protein | - |
| O2604_RS00655 (O2604_00655) | 142513..143421 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
| O2604_RS00660 (O2604_00660) | 143721..144002 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
| O2604_RS00665 (O2604_00665) | 143999..144226 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| O2604_RS00670 (O2604_00670) | 144402..145022 | - | 621 | WP_003101226.1 | hypothetical protein | - |
| O2604_RS00675 (O2604_00675) | 145123..145623 | + | 501 | WP_003101228.1 | LEA type 2 family protein | - |
| O2604_RS00680 (O2604_00680) | 145696..146037 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
| O2604_RS00685 (O2604_00685) | 146119..147546 | - | 1428 | WP_088170997.1 | GABA permease | - |
| O2604_RS00690 (O2604_00690) | 147715..149208 | - | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T266633 WP_003083773.1 NZ_CP114374:c144002-143721 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|