Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
| Location | 820725..821353 | Replicon | chromosome |
| Accession | NZ_CP114372 | ||
| Organism | Aeromicrobium sp. HA | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | O3S82_RS04005 | Protein ID | WP_269305683.1 |
| Coordinates | 820725..821120 (-) | Length | 132 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | O3S82_RS04010 | Protein ID | WP_269305685.1 |
| Coordinates | 821117..821353 (-) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O3S82_RS03995 | 816729..819857 | + | 3129 | WP_269305680.1 | ATP-dependent DNA helicase | - |
| O3S82_RS04000 | 819861..820724 | + | 864 | WP_269305682.1 | NAD(+) diphosphatase | - |
| O3S82_RS04005 | 820725..821120 | - | 396 | WP_269305683.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| O3S82_RS04010 | 821117..821353 | - | 237 | WP_269305685.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| O3S82_RS04015 | 821399..821644 | - | 246 | WP_269305687.1 | mycoredoxin | - |
| O3S82_RS04020 | 821796..823787 | + | 1992 | WP_269305689.1 | 3'-5' exonuclease | - |
| O3S82_RS04025 | 823791..825152 | - | 1362 | WP_269305691.1 | AarF/ABC1/UbiB kinase family protein | - |
| O3S82_RS04030 | 825189..825980 | - | 792 | WP_179425888.1 | hypothetical protein | - |
| O3S82_RS04035 | 826077..826235 | - | 159 | WP_179425886.1 | DUF5679 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14185.96 Da Isoelectric Point: 4.4840
>T266631 WP_269305683.1 NZ_CP114372:c821120-820725 [Aeromicrobium sp. HA]
VIVDTSAVVAVIKREAGWEAIDRALAAATTPRMSAGTQLELGIVVDQARDPELSRLVDALLRDWSVEIEPVTAEHARIAR
EAYRDYGRGSGHRARLNYGDCFAYALASQSGEPLLYVGDDFAATDLTPVLV
VIVDTSAVVAVIKREAGWEAIDRALAAATTPRMSAGTQLELGIVVDQARDPELSRLVDALLRDWSVEIEPVTAEHARIAR
EAYRDYGRGSGHRARLNYGDCFAYALASQSGEPLLYVGDDFAATDLTPVLV
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|