Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/-
Location 25634..26226 Replicon plasmid unnamed4
Accession NZ_CP114365
Organism Klebsiella variicola strain 2022CK-00568

Toxin (Protein)


Gene name hicA Uniprot ID V0AGQ2
Locus tag OPU52_RS29725 Protein ID WP_000520549.1
Coordinates 25978..26226 (-) Length 83 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID V0AWG0
Locus tag OPU52_RS29720 Protein ID WP_000681613.1
Coordinates 25634..25981 (-) Length 116 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OPU52_RS29690 (OPU52_29685) 21639..21965 - 327 WP_000008647.1 TrbC/VirB2 family protein -
OPU52_RS29695 (OPU52_29690) 21979..22599 - 621 WP_000157549.1 lytic transglycosylase domain-containing protein -
OPU52_RS29700 (OPU52_29695) 22955..23170 - 216 WP_000760375.1 EexN family lipoprotein -
OPU52_RS29705 (OPU52_29700) 23167..23460 - 294 WP_000134733.1 sigma factor-like helix-turn-helix DNA-binding protein -
OPU52_RS29710 (OPU52_29705) 23537..24766 - 1230 WP_001329504.1 DNA relaxase/nickase TaxC -
OPU52_RS29715 (OPU52_29710) 24770..25273 - 504 WP_000781813.1 relaxosome-coupling protein TaxA -
OPU52_RS29720 (OPU52_29715) 25634..25981 - 348 WP_000681613.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
OPU52_RS29725 (OPU52_29720) 25978..26226 - 249 WP_000520549.1 type II toxin-antitoxin system HicA family toxin Toxin
OPU52_RS29730 (OPU52_29725) 26531..26881 - 351 WP_000854259.1 hypothetical protein -
OPU52_RS29735 (OPU52_29730) 26972..27271 - 300 WP_000650309.1 hypothetical protein -
OPU52_RS29740 (OPU52_29735) 27725..27952 - 228 WP_000801440.1 hypothetical protein -
OPU52_RS29745 (OPU52_29740) 27939..28190 - 252 WP_001230707.1 hypothetical protein -
OPU52_RS29750 (OPU52_29745) 28187..28729 - 543 WP_001083906.1 hypothetical protein -
OPU52_RS29755 (OPU52_29750) 28834..29349 - 516 WP_001025395.1 J domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..29750 29750


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(20-81)

Antitoxin

Uncharacterised protein family HicB

(54-104)


Sequences

Toxin        


Download         Length: 83 a.a.        Molecular weight: 9422.08 Da        Isoelectric Point: 10.4800

>T266630 WP_000520549.1 NZ_CP114365:c26226-25978 [Klebsiella variicola]
MGKTDKLLAKFLNSKKTFEWDELVVLFSSLGYVKKEMQGSRVRFFNAEINHTILMHRPHPESYIKGGTLKAIKQNLKEAG
LL

Download         Length: 249 bp

Antitoxin


Download         Length: 116 a.a.        Molecular weight: 13113.84 Da        Isoelectric Point: 4.6723

>AT266630 WP_000681613.1 NZ_CP114365:c25981-25634 [Klebsiella variicola]
MKHLKYKGYLGTVEPDFENNVLYGKLAFIRDLVTYEASTLAELEQEFKTSVDLYLQSCVEDGKEPDTPFKGVFNVRLDPE
LHRRVAEMAMEEDLSLNAFVNKALEKEVSNHRAGA

Download         Length: 348 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CIX3

Antitoxin

Source ID Structure
AlphaFold DB A0A829CLC1

References