Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4295543..4296162 Replicon chromosome
Accession NZ_CP114361
Organism Klebsiella variicola strain 2022CK-00568

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag OPU52_RS20890 Protein ID WP_002892050.1
Coordinates 4295944..4296162 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A1F2MBN7
Locus tag OPU52_RS20885 Protein ID WP_008805436.1
Coordinates 4295543..4295917 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OPU52_RS20875 (OPU52_20870) 4290698..4291891 + 1194 WP_012542667.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
OPU52_RS20880 (OPU52_20875) 4291914..4295060 + 3147 WP_008805437.1 multidrug efflux RND transporter permease subunit AcrB -
OPU52_RS20885 (OPU52_20880) 4295543..4295917 + 375 WP_008805436.1 Hha toxicity modulator TomB Antitoxin
OPU52_RS20890 (OPU52_20885) 4295944..4296162 + 219 WP_002892050.1 HHA domain-containing protein Toxin
OPU52_RS20895 (OPU52_20890) 4296321..4296887 + 567 WP_008805435.1 maltose O-acetyltransferase -
OPU52_RS20900 (OPU52_20895) 4296859..4296987 - 129 Protein_4101 hypothetical protein -
OPU52_RS20905 (OPU52_20900) 4297024..4297494 + 471 WP_008805434.1 YlaC family protein -
OPU52_RS20910 (OPU52_20905) 4297463..4298920 - 1458 WP_110242785.1 PLP-dependent aminotransferase family protein -
OPU52_RS20915 (OPU52_20910) 4299021..4299719 + 699 WP_032438712.1 GNAT family protein -
OPU52_RS20920 (OPU52_20915) 4299716..4299856 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
OPU52_RS20925 (OPU52_20920) 4299856..4300119 - 264 WP_008805431.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T266622 WP_002892050.1 NZ_CP114361:4295944-4296162 [Klebsiella variicola]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14384.06 Da        Isoelectric Point: 4.8989

>AT266622 WP_008805436.1 NZ_CP114361:4295543-4295917 [Klebsiella variicola]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYTEDNKLVAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A1F2MBN7

References