Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 795087..795744 | Replicon | chromosome |
Accession | NZ_CP114361 | ||
Organism | Klebsiella variicola strain 2022CK-00568 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | W8UCT0 |
Locus tag | OPU52_RS03915 | Protein ID | WP_002916310.1 |
Coordinates | 795334..795744 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | OPU52_RS03910 | Protein ID | WP_002916312.1 |
Coordinates | 795087..795353 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OPU52_RS03885 (OPU52_03885) | 791529..792257 | - | 729 | WP_012967245.1 | MurR/RpiR family transcriptional regulator | - |
OPU52_RS03890 (OPU52_03890) | 792308..792619 | + | 312 | WP_015369789.1 | N(4)-acetylcytidine aminohydrolase | - |
OPU52_RS03895 (OPU52_03895) | 792783..793442 | + | 660 | WP_008806429.1 | hemolysin III family protein | - |
OPU52_RS03900 (OPU52_03900) | 793473..793811 | + | 339 | WP_145940792.1 | hypothetical protein | - |
OPU52_RS03905 (OPU52_03905) | 793858..794841 | - | 984 | WP_023340714.1 | tRNA-modifying protein YgfZ | - |
OPU52_RS03910 (OPU52_03910) | 795087..795353 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
OPU52_RS03915 (OPU52_03915) | 795334..795744 | + | 411 | WP_002916310.1 | protein YgfX | Toxin |
OPU52_RS03920 (OPU52_03920) | 795751..796272 | - | 522 | WP_008806427.1 | flavodoxin FldB | - |
OPU52_RS03925 (OPU52_03925) | 796373..797269 | + | 897 | WP_008806426.1 | site-specific tyrosine recombinase XerD | - |
OPU52_RS03930 (OPU52_03930) | 797292..798005 | + | 714 | WP_012540593.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
OPU52_RS03935 (OPU52_03935) | 798011..799744 | + | 1734 | WP_032736401.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T266612 WP_002916310.1 NZ_CP114361:795334-795744 [Klebsiella variicola]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GSW7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |