Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 342196..342782 Replicon chromosome
Accession NZ_CP114361
Organism Klebsiella variicola strain 2022CK-00568

Toxin (Protein)


Gene name doc Uniprot ID A0A2W7TCK5
Locus tag OPU52_RS01575 Protein ID WP_008806973.1
Coordinates 342414..342782 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag OPU52_RS01570 Protein ID WP_004174006.1
Coordinates 342196..342417 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OPU52_RS01550 (OPU52_01550) 338345..339271 + 927 WP_012540389.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
OPU52_RS01555 (OPU52_01555) 339268..340545 + 1278 WP_008806971.1 branched chain amino acid ABC transporter permease LivM -
OPU52_RS01560 (OPU52_01560) 340542..341309 + 768 WP_008806972.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
OPU52_RS01565 (OPU52_01565) 341311..342024 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
OPU52_RS01570 (OPU52_01570) 342196..342417 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OPU52_RS01575 (OPU52_01575) 342414..342782 + 369 WP_008806973.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
OPU52_RS01580 (OPU52_01580) 343074..344390 + 1317 WP_269136587.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
OPU52_RS01585 (OPU52_01585) 344492..345379 + 888 WP_012967120.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
OPU52_RS01590 (OPU52_01590) 345376..346221 + 846 WP_048268283.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
OPU52_RS01595 (OPU52_01595) 346223..347293 + 1071 WP_044649551.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 339268..348030 8762


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(6-116)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13639.01 Da        Isoelectric Point: 7.3191

>T266610 WP_008806973.1 NZ_CP114361:342414-342782 [Klebsiella variicola]
MTLQIISAEEIIQFHDRLLRVTPDVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLVISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT266610 WP_004174006.1 NZ_CP114361:342196-342417 [Klebsiella variicola]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2W7TCK5

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References