Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4258722..4259341 Replicon chromosome
Accession NZ_CP114354
Organism Klebsiella variicola strain 2022CK-00567

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag OPU51_RS20750 Protein ID WP_002892050.1
Coordinates 4259123..4259341 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A1F2MBN7
Locus tag OPU51_RS20745 Protein ID WP_008805436.1
Coordinates 4258722..4259096 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OPU51_RS20735 (OPU51_20735) 4253877..4255070 + 1194 WP_012542667.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
OPU51_RS20740 (OPU51_20740) 4255093..4258239 + 3147 WP_008805437.1 multidrug efflux RND transporter permease subunit AcrB -
OPU51_RS20745 (OPU51_20745) 4258722..4259096 + 375 WP_008805436.1 Hha toxicity modulator TomB Antitoxin
OPU51_RS20750 (OPU51_20750) 4259123..4259341 + 219 WP_002892050.1 HHA domain-containing protein Toxin
OPU51_RS20755 (OPU51_20755) 4259500..4260066 + 567 WP_008805435.1 maltose O-acetyltransferase -
OPU51_RS20760 (OPU51_20760) 4260038..4260166 - 129 Protein_4073 hypothetical protein -
OPU51_RS20765 (OPU51_20765) 4260203..4260673 + 471 WP_008805434.1 YlaC family protein -
OPU51_RS20770 (OPU51_20770) 4260642..4262099 - 1458 WP_110242785.1 PLP-dependent aminotransferase family protein -
OPU51_RS20775 (OPU51_20775) 4262200..4262898 + 699 WP_032438712.1 GNAT family protein -
OPU51_RS20780 (OPU51_20780) 4262895..4263035 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
OPU51_RS20785 (OPU51_20785) 4263035..4263298 - 264 WP_008805431.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T266602 WP_002892050.1 NZ_CP114354:4259123-4259341 [Klebsiella variicola]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14384.06 Da        Isoelectric Point: 4.8989

>AT266602 WP_008805436.1 NZ_CP114354:4258722-4259096 [Klebsiella variicola]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYTEDNKLVAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A1F2MBN7

References