Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4258722..4259341 | Replicon | chromosome |
| Accession | NZ_CP114354 | ||
| Organism | Klebsiella variicola strain 2022CK-00567 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | OPU51_RS20750 | Protein ID | WP_002892050.1 |
| Coordinates | 4259123..4259341 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A1F2MBN7 |
| Locus tag | OPU51_RS20745 | Protein ID | WP_008805436.1 |
| Coordinates | 4258722..4259096 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OPU51_RS20735 (OPU51_20735) | 4253877..4255070 | + | 1194 | WP_012542667.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| OPU51_RS20740 (OPU51_20740) | 4255093..4258239 | + | 3147 | WP_008805437.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| OPU51_RS20745 (OPU51_20745) | 4258722..4259096 | + | 375 | WP_008805436.1 | Hha toxicity modulator TomB | Antitoxin |
| OPU51_RS20750 (OPU51_20750) | 4259123..4259341 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| OPU51_RS20755 (OPU51_20755) | 4259500..4260066 | + | 567 | WP_008805435.1 | maltose O-acetyltransferase | - |
| OPU51_RS20760 (OPU51_20760) | 4260038..4260166 | - | 129 | Protein_4073 | hypothetical protein | - |
| OPU51_RS20765 (OPU51_20765) | 4260203..4260673 | + | 471 | WP_008805434.1 | YlaC family protein | - |
| OPU51_RS20770 (OPU51_20770) | 4260642..4262099 | - | 1458 | WP_110242785.1 | PLP-dependent aminotransferase family protein | - |
| OPU51_RS20775 (OPU51_20775) | 4262200..4262898 | + | 699 | WP_032438712.1 | GNAT family protein | - |
| OPU51_RS20780 (OPU51_20780) | 4262895..4263035 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| OPU51_RS20785 (OPU51_20785) | 4263035..4263298 | - | 264 | WP_008805431.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T266602 WP_002892050.1 NZ_CP114354:4259123-4259341 [Klebsiella variicola]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14384.06 Da Isoelectric Point: 4.8989
>AT266602 WP_008805436.1 NZ_CP114354:4258722-4259096 [Klebsiella variicola]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYTEDNKLVAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYTEDNKLVAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1F2MBN7 |