Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hipBA/HipA-couple_hipB |
Location | 1724072..1725069 | Replicon | chromosome |
Accession | NZ_CP114354 | ||
Organism | Klebsiella variicola strain 2022CK-00567 |
Toxin (Protein)
Gene name | hipA | Uniprot ID | - |
Locus tag | OPU51_RS08410 | Protein ID | WP_229531768.1 |
Coordinates | 1724515..1725069 (-) | Length | 185 a.a. |
Antitoxin (Protein)
Gene name | hipB | Uniprot ID | A0A1F2MDT5 |
Locus tag | OPU51_RS08405 | Protein ID | WP_012541033.1 |
Coordinates | 1724072..1724518 (-) | Length | 149 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OPU51_RS08390 (OPU51_08390) | 1720367..1721365 | + | 999 | WP_008804028.1 | galactose/glucose ABC transporter substrate-binding protein MglB | - |
OPU51_RS08395 (OPU51_08395) | 1721484..1723004 | + | 1521 | WP_008804029.1 | galactose/methyl galactoside ABC transporter ATP-binding protein MglA | - |
OPU51_RS08400 (OPU51_08400) | 1723020..1724030 | + | 1011 | WP_002912871.1 | galactose/methyl galactoside ABC transporter permease MglC | - |
OPU51_RS08405 (OPU51_08405) | 1724072..1724518 | - | 447 | WP_012541033.1 | helix-turn-helix transcriptional regulator | Antitoxin |
OPU51_RS08410 (OPU51_08410) | 1724515..1725069 | - | 555 | WP_229531768.1 | HipA domain-containing protein | Toxin |
OPU51_RS08415 (OPU51_08415) | 1725098..1725619 | - | 522 | WP_025714688.1 | hypothetical protein | - |
OPU51_RS08420 (OPU51_08420) | 1725734..1726465 | - | 732 | WP_008804033.1 | outer membrane permeability protein SanA | - |
OPU51_RS08425 (OPU51_08425) | 1726758..1727642 | - | 885 | WP_262266825.1 | cytidine deaminase | - |
OPU51_RS08430 (OPU51_08430) | 1727771..1728466 | - | 696 | WP_061153873.1 | CidB/LrgB family autolysis modulator | - |
OPU51_RS08435 (OPU51_08435) | 1728456..1728860 | - | 405 | WP_004201620.1 | CidA/LrgA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 185 a.a. Molecular weight: 20710.03 Da Isoelectric Point: 5.7891
>T266594 WP_229531768.1 NZ_CP114354:c1725069-1724515 [Klebsiella variicola]
MRLGMESVYSLLQKAPATILDHETTLRILIEKITSSNMVRVQNYRFDVQGFIIDWVRRDLLNIIFGNSDNHGRNTAFMKA
DNEIILAPIYDFAPMKADPEGIPRTMKWSLACESGGEYNFGAIAQALAEWITPDTLLNALSETASQLVDLPSRLKVRGVP
VQILEMPSIGFKFIPDKLARWGLL
MRLGMESVYSLLQKAPATILDHETTLRILIEKITSSNMVRVQNYRFDVQGFIIDWVRRDLLNIIFGNSDNHGRNTAFMKA
DNEIILAPIYDFAPMKADPEGIPRTMKWSLACESGGEYNFGAIAQALAEWITPDTLLNALSETASQLVDLPSRLKVRGVP
VQILEMPSIGFKFIPDKLARWGLL
Download Length: 555 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16396.05 Da Isoelectric Point: 10.5417
>AT266594 WP_012541033.1 NZ_CP114354:c1724518-1724072 [Klebsiella variicola]
MKTLNKKETEIQNTLARLRADNPPSLPATGVTATEKKARSEISRQRVSAGLKKVKTVDRQAVIHAIIHDIMLGAISQGEA
LKKLRVEVLGLRQDEYARLVDVSRKTLSDVENDKGNYSAEIINKIYKPFGLETGLVPISKTLISSLFK
MKTLNKKETEIQNTLARLRADNPPSLPATGVTATEKKARSEISRQRVSAGLKKVKTVDRQAVIHAIIHDIMLGAISQGEA
LKKLRVEVLGLRQDEYARLVDVSRKTLSDVENDKGNYSAEIINKIYKPFGLETGLVPISKTLISSLFK
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|