Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4294344..4294963 Replicon chromosome
Accession NZ_CP114332
Organism Klebsiella variicola strain 2022CK-00505

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag OGU18_RS20885 Protein ID WP_002892050.1
Coordinates 4294745..4294963 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A1F2MBN7
Locus tag OGU18_RS20880 Protein ID WP_008805436.1
Coordinates 4294344..4294718 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OGU18_RS20870 (OGU18_20865) 4289499..4290692 + 1194 WP_012542667.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
OGU18_RS20875 (OGU18_20870) 4290715..4293861 + 3147 WP_008805437.1 multidrug efflux RND transporter permease subunit AcrB -
OGU18_RS20880 (OGU18_20875) 4294344..4294718 + 375 WP_008805436.1 Hha toxicity modulator TomB Antitoxin
OGU18_RS20885 (OGU18_20880) 4294745..4294963 + 219 WP_002892050.1 HHA domain-containing protein Toxin
OGU18_RS20890 (OGU18_20885) 4295122..4295688 + 567 WP_008805435.1 maltose O-acetyltransferase -
OGU18_RS20895 (OGU18_20890) 4295660..4295788 - 129 Protein_4100 hypothetical protein -
OGU18_RS20900 (OGU18_20895) 4295825..4296295 + 471 WP_008805434.1 YlaC family protein -
OGU18_RS20905 (OGU18_20900) 4296264..4297721 - 1458 WP_110242785.1 PLP-dependent aminotransferase family protein -
OGU18_RS20910 (OGU18_20905) 4297822..4298520 + 699 WP_032438712.1 GNAT family protein -
OGU18_RS20915 (OGU18_20910) 4298517..4298657 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
OGU18_RS20920 (OGU18_20915) 4298657..4298920 - 264 WP_008805431.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T266584 WP_002892050.1 NZ_CP114332:4294745-4294963 [Klebsiella variicola]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14384.06 Da        Isoelectric Point: 4.8989

>AT266584 WP_008805436.1 NZ_CP114332:4294344-4294718 [Klebsiella variicola]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYTEDNKLVAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A1F2MBN7

References