Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4295544..4296163 | Replicon | chromosome |
Accession | NZ_CP114328 | ||
Organism | Klebsiella variicola strain 2022CK-00504 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | OEE49_RS20890 | Protein ID | WP_002892050.1 |
Coordinates | 4295945..4296163 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | A0A1F2MBN7 |
Locus tag | OEE49_RS20885 | Protein ID | WP_008805436.1 |
Coordinates | 4295544..4295918 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OEE49_RS20875 (OEE49_20870) | 4290699..4291892 | + | 1194 | WP_012542667.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
OEE49_RS20880 (OEE49_20875) | 4291915..4295061 | + | 3147 | WP_008805437.1 | multidrug efflux RND transporter permease subunit AcrB | - |
OEE49_RS20885 (OEE49_20880) | 4295544..4295918 | + | 375 | WP_008805436.1 | Hha toxicity modulator TomB | Antitoxin |
OEE49_RS20890 (OEE49_20885) | 4295945..4296163 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
OEE49_RS20895 (OEE49_20890) | 4296322..4296888 | + | 567 | WP_008805435.1 | maltose O-acetyltransferase | - |
OEE49_RS20900 (OEE49_20895) | 4296860..4296988 | - | 129 | Protein_4101 | hypothetical protein | - |
OEE49_RS20905 (OEE49_20900) | 4297025..4297495 | + | 471 | WP_008805434.1 | YlaC family protein | - |
OEE49_RS20910 (OEE49_20905) | 4297464..4298921 | - | 1458 | WP_110242785.1 | PLP-dependent aminotransferase family protein | - |
OEE49_RS20915 (OEE49_20910) | 4299022..4299720 | + | 699 | WP_032438712.1 | GNAT family protein | - |
OEE49_RS20920 (OEE49_20915) | 4299717..4299857 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
OEE49_RS20925 (OEE49_20920) | 4299857..4300120 | - | 264 | WP_008805431.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T266565 WP_002892050.1 NZ_CP114328:4295945-4296163 [Klebsiella variicola]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14384.06 Da Isoelectric Point: 4.8989
>AT266565 WP_008805436.1 NZ_CP114328:4295544-4295918 [Klebsiella variicola]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYTEDNKLVAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYTEDNKLVAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1F2MBN7 |