Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4293953..4294572 Replicon chromosome
Accession NZ_CP114324
Organism Klebsiella variicola strain 2022CK-00503

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag OEE48_RS20870 Protein ID WP_002892050.1
Coordinates 4294354..4294572 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A1F2MBN7
Locus tag OEE48_RS20865 Protein ID WP_008805436.1
Coordinates 4293953..4294327 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OEE48_RS20855 (OEE48_20850) 4289108..4290301 + 1194 WP_012542667.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
OEE48_RS20860 (OEE48_20855) 4290324..4293470 + 3147 WP_008805437.1 multidrug efflux RND transporter permease subunit AcrB -
OEE48_RS20865 (OEE48_20860) 4293953..4294327 + 375 WP_008805436.1 Hha toxicity modulator TomB Antitoxin
OEE48_RS20870 (OEE48_20865) 4294354..4294572 + 219 WP_002892050.1 HHA domain-containing protein Toxin
OEE48_RS20875 (OEE48_20870) 4294731..4295297 + 567 WP_008805435.1 maltose O-acetyltransferase -
OEE48_RS20880 (OEE48_20875) 4295269..4295397 - 129 Protein_4099 hypothetical protein -
OEE48_RS20885 (OEE48_20880) 4295434..4295904 + 471 WP_008805434.1 YlaC family protein -
OEE48_RS20890 (OEE48_20885) 4295873..4297330 - 1458 WP_110242785.1 PLP-dependent aminotransferase family protein -
OEE48_RS20895 (OEE48_20890) 4297431..4298129 + 699 WP_032438712.1 GNAT family protein -
OEE48_RS20900 (OEE48_20895) 4298126..4298266 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
OEE48_RS20905 (OEE48_20900) 4298266..4298529 - 264 WP_008805431.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T266546 WP_002892050.1 NZ_CP114324:4294354-4294572 [Klebsiella variicola]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14384.06 Da        Isoelectric Point: 4.8989

>AT266546 WP_008805436.1 NZ_CP114324:4293953-4294327 [Klebsiella variicola]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYTEDNKLVAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A1F2MBN7

References