Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 67402..68138 | Replicon | plasmid unnamed1 |
Accession | NZ_CP114321 | ||
Organism | Klebsiella variicola strain 2022CK-00502 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | L7SZ15 |
Locus tag | OEE46_RS27275 | Protein ID | WP_003026803.1 |
Coordinates | 67656..68138 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | L7SZ29 |
Locus tag | OEE46_RS27270 | Protein ID | WP_003026799.1 |
Coordinates | 67402..67668 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OEE46_RS27235 (OEE46_27230) | 63246..63608 | - | 363 | WP_004206665.1 | arsenite efflux transporter metallochaperone ArsD | - |
OEE46_RS27240 (OEE46_27235) | 63660..64010 | - | 351 | WP_004206664.1 | As(III)-sensing metalloregulatory transcriptional repressor ArsR | - |
OEE46_RS27245 (OEE46_27240) | 64368..64616 | + | 249 | WP_004193994.1 | hypothetical protein | - |
OEE46_RS27250 (OEE46_27245) | 64613..65824 | + | 1212 | WP_032415728.1 | hypothetical protein | - |
OEE46_RS27255 (OEE46_27250) | 65958..66449 | + | 492 | WP_004206662.1 | hypothetical protein | - |
OEE46_RS27260 (OEE46_27255) | 66510..66713 | + | 204 | WP_004206661.1 | HHA domain-containing protein | - |
OEE46_RS27265 (OEE46_27260) | 66727..66957 | + | 231 | WP_004206660.1 | hypothetical protein | - |
OEE46_RS27270 (OEE46_27265) | 67402..67668 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
OEE46_RS27275 (OEE46_27270) | 67656..68138 | + | 483 | WP_003026803.1 | GNAT family N-acetyltransferase | Toxin |
OEE46_RS27280 (OEE46_27275) | 68339..69742 | + | 1404 | WP_001567368.1 | ISNCY-like element ISKpn21 family transposase | - |
OEE46_RS27285 (OEE46_27280) | 69771..70403 | - | 633 | WP_001567369.1 | hypothetical protein | - |
OEE46_RS27290 (OEE46_27285) | 70629..71975 | + | 1347 | WP_064152331.1 | ISNCY family transposase | - |
OEE46_RS27295 (OEE46_27290) | 72024..72419 | + | 396 | WP_048268429.1 | helix-turn-helix domain-containing protein | - |
OEE46_RS27300 (OEE46_27295) | 72572..72682 | - | 111 | Protein_75 | IS3 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..236561 | 236561 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17353.97 Da Isoelectric Point: 9.5822
>T266531 WP_003026803.1 NZ_CP114321:67656-68138 [Klebsiella variicola]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J2GNW6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q8YL66 |