Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4295410..4296029 | Replicon | chromosome |
| Accession | NZ_CP114320 | ||
| Organism | Klebsiella variicola strain 2022CK-00502 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | OEE46_RS20890 | Protein ID | WP_002892050.1 |
| Coordinates | 4295811..4296029 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A1F2MBN7 |
| Locus tag | OEE46_RS20885 | Protein ID | WP_008805436.1 |
| Coordinates | 4295410..4295784 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OEE46_RS20875 (OEE46_20870) | 4290565..4291758 | + | 1194 | WP_012542667.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| OEE46_RS20880 (OEE46_20875) | 4291781..4294927 | + | 3147 | WP_008805437.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| OEE46_RS20885 (OEE46_20880) | 4295410..4295784 | + | 375 | WP_008805436.1 | Hha toxicity modulator TomB | Antitoxin |
| OEE46_RS20890 (OEE46_20885) | 4295811..4296029 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| OEE46_RS20895 (OEE46_20890) | 4296188..4296754 | + | 567 | WP_008805435.1 | maltose O-acetyltransferase | - |
| OEE46_RS20900 (OEE46_20895) | 4296726..4296854 | - | 129 | Protein_4101 | hypothetical protein | - |
| OEE46_RS20905 (OEE46_20900) | 4296891..4297361 | + | 471 | WP_008805434.1 | YlaC family protein | - |
| OEE46_RS20910 (OEE46_20905) | 4297330..4298787 | - | 1458 | WP_110242785.1 | PLP-dependent aminotransferase family protein | - |
| OEE46_RS20915 (OEE46_20910) | 4298888..4299586 | + | 699 | WP_032438712.1 | GNAT family protein | - |
| OEE46_RS20920 (OEE46_20915) | 4299583..4299723 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| OEE46_RS20925 (OEE46_20920) | 4299723..4299986 | - | 264 | WP_008805431.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T266527 WP_002892050.1 NZ_CP114320:4295811-4296029 [Klebsiella variicola]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14384.06 Da Isoelectric Point: 4.8989
>AT266527 WP_008805436.1 NZ_CP114320:4295410-4295784 [Klebsiella variicola]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYTEDNKLVAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYTEDNKLVAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1F2MBN7 |