Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 1910305..1910895 | Replicon | chromosome |
Accession | NZ_CP114320 | ||
Organism | Klebsiella variicola strain 2022CK-00502 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | A0A1F2LYA2 |
Locus tag | OEE46_RS09225 | Protein ID | WP_008804165.1 |
Coordinates | 1910563..1910895 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | A0A1F2LZQ3 |
Locus tag | OEE46_RS09220 | Protein ID | WP_012541132.1 |
Coordinates | 1910305..1910562 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OEE46_RS09200 (OEE46_09200) | 1905913..1906488 | + | 576 | WP_012541129.1 | hypothetical protein | - |
OEE46_RS09205 (OEE46_09205) | 1906667..1907503 | + | 837 | WP_008804155.1 | alpha/beta hydrolase | - |
OEE46_RS09210 (OEE46_09210) | 1907710..1908681 | + | 972 | WP_016161433.1 | sensor domain-containing diguanylate cyclase | - |
OEE46_RS09215 (OEE46_09215) | 1908678..1909778 | - | 1101 | WP_070612302.1 | AarF/UbiB family protein | - |
OEE46_RS09220 (OEE46_09220) | 1910305..1910562 | + | 258 | WP_012541132.1 | antitoxin | Antitoxin |
OEE46_RS09225 (OEE46_09225) | 1910563..1910895 | + | 333 | WP_008804165.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
OEE46_RS09235 (OEE46_09235) | 1911218..1912654 | + | 1437 | WP_269136626.1 | EmmdR/YeeO family multidrug/toxin efflux MATE transporter | - |
OEE46_RS09245 (OEE46_09245) | 1912912..1913244 | - | 333 | WP_046881584.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
OEE46_RS09250 (OEE46_09250) | 1913245..1913463 | - | 219 | WP_046881585.1 | antitoxin | - |
OEE46_RS09255 (OEE46_09255) | 1913775..1914755 | - | 981 | WP_000019445.1 | IS5-like element ISKpn26 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1913775..1914755 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11867.71 Da Isoelectric Point: 10.1839
>T266519 WP_008804165.1 NZ_CP114320:1910563-1910895 [Klebsiella variicola]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEEAGTKTTGVIRCDQPRTI
DMAARNGKRLERIPDAVVNEVLARLDAILS
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEEAGTKTTGVIRCDQPRTI
DMAARNGKRLERIPDAVVNEVLARLDAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1F2LYA2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1F2LZQ3 |