Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 795088..795745 | Replicon | chromosome |
Accession | NZ_CP114316 | ||
Organism | Klebsiella variicola strain 2022CK-00501 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | W8UCT0 |
Locus tag | OGU15_RS03915 | Protein ID | WP_002916310.1 |
Coordinates | 795335..795745 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | OGU15_RS03910 | Protein ID | WP_002916312.1 |
Coordinates | 795088..795354 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OGU15_RS03885 (OGU15_03885) | 791530..792258 | - | 729 | WP_012967245.1 | MurR/RpiR family transcriptional regulator | - |
OGU15_RS03890 (OGU15_03890) | 792309..792620 | + | 312 | WP_015369789.1 | N(4)-acetylcytidine aminohydrolase | - |
OGU15_RS03895 (OGU15_03895) | 792784..793443 | + | 660 | WP_008806429.1 | hemolysin III family protein | - |
OGU15_RS03900 (OGU15_03900) | 793474..793812 | + | 339 | WP_145940792.1 | hypothetical protein | - |
OGU15_RS03905 (OGU15_03905) | 793859..794842 | - | 984 | WP_023340714.1 | tRNA-modifying protein YgfZ | - |
OGU15_RS03910 (OGU15_03910) | 795088..795354 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
OGU15_RS03915 (OGU15_03915) | 795335..795745 | + | 411 | WP_002916310.1 | protein YgfX | Toxin |
OGU15_RS03920 (OGU15_03920) | 795752..796273 | - | 522 | WP_008806427.1 | flavodoxin FldB | - |
OGU15_RS03925 (OGU15_03925) | 796374..797270 | + | 897 | WP_008806426.1 | site-specific tyrosine recombinase XerD | - |
OGU15_RS03930 (OGU15_03930) | 797293..798006 | + | 714 | WP_012540593.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
OGU15_RS03935 (OGU15_03935) | 798012..799745 | + | 1734 | WP_032736401.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T266498 WP_002916310.1 NZ_CP114316:795335-795745 [Klebsiella variicola]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GSW7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |