Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 7369..8012 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP114313 | ||
| Organism | Klebsiella variicola strain 2022CK-00500 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | D8L2J9 |
| Locus tag | OEE47_RS26955 | Protein ID | WP_001044770.1 |
| Coordinates | 7596..8012 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D5KTK7 |
| Locus tag | OEE47_RS26950 | Protein ID | WP_001261282.1 |
| Coordinates | 7369..7599 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OEE47_RS26925 (OEE47_26920) | 2994..3974 | - | 981 | WP_014386491.1 | IS5-like element ISKpn26 family transposase | - |
| OEE47_RS26930 (OEE47_26925) | 4028..4807 | + | 780 | WP_269136667.1 | hypothetical protein | - |
| OEE47_RS26935 (OEE47_26930) | 4992..6320 | + | 1329 | WP_004206607.1 | nucleotidyltransferase | - |
| OEE47_RS26940 (OEE47_26935) | 6328..6903 | + | 576 | WP_004206608.1 | SLATT domain-containing protein | - |
| OEE47_RS26945 (OEE47_26940) | 7170..7412 | - | 243 | Protein_6 | hypothetical protein | - |
| OEE47_RS26950 (OEE47_26945) | 7369..7599 | + | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| OEE47_RS26955 (OEE47_26950) | 7596..8012 | + | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OEE47_RS26960 (OEE47_26955) | 8086..9648 | + | 1563 | WP_004206609.1 | AAA family ATPase | - |
| OEE47_RS26965 (OEE47_26960) | 9633..10655 | + | 1023 | WP_000361404.1 | helicase UvrD | - |
| OEE47_RS26970 (OEE47_26965) | 11199..12107 | + | 909 | WP_032426221.1 | HNH endonuclease | - |
| OEE47_RS26975 (OEE47_26970) | 12293..12643 | - | 351 | WP_004187110.1 | DUF305 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..236560 | 236560 | |
| - | flank | IS/Tn | - | - | 2994..3974 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T266492 WP_001044770.1 NZ_CP114313:7596-8012 [Klebsiella variicola]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GYM2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GZG3 |