Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/- |
Location | 301363..301994 | Replicon | chromosome |
Accession | NZ_CP114312 | ||
Organism | Klebsiella variicola strain 2022CK-00500 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A2V3KJT3 |
Locus tag | OEE47_RS01365 | Protein ID | WP_044650325.1 |
Coordinates | 301363..301638 (+) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | R4YIG2 |
Locus tag | OEE47_RS01370 | Protein ID | WP_004181489.1 |
Coordinates | 301635..301994 (+) | Length | 120 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OEE47_RS01345 (OEE47_01345) | 296599..296934 | + | 336 | WP_002921203.1 | universal stress protein UspB | - |
OEE47_RS01350 (OEE47_01350) | 296994..298490 | - | 1497 | WP_008806938.1 | inorganic phosphate transporter PitA | - |
OEE47_RS01355 (OEE47_01355) | 298720..299913 | + | 1194 | WP_012967106.1 | NAD(P)/FAD-dependent oxidoreductase | - |
OEE47_RS01360 (OEE47_01360) | 299953..300966 | - | 1014 | WP_008806942.1 | magnesium transporter | - |
OEE47_RS01365 (OEE47_01365) | 301363..301638 | + | 276 | WP_044650325.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
OEE47_RS01370 (OEE47_01370) | 301635..301994 | + | 360 | WP_004181489.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
OEE47_RS01375 (OEE47_01375) | 302022..302423 | - | 402 | WP_032733900.1 | nickel-responsive transcriptional regulator NikR | - |
OEE47_RS01380 (OEE47_01380) | 302411..303202 | - | 792 | WP_012540373.1 | nickel import ATP-binding protein NikE | - |
OEE47_RS01385 (OEE47_01385) | 303199..303963 | - | 765 | WP_008806946.1 | nickel import ATP-binding protein NikD | - |
OEE47_RS01390 (OEE47_01390) | 303963..304796 | - | 834 | WP_012967107.1 | nickel ABC transporter permease subunit NikC | - |
OEE47_RS01395 (OEE47_01395) | 304793..305737 | - | 945 | WP_016161924.1 | nickel ABC transporter permease subunit NikB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10279.91 Da Isoelectric Point: 10.3165
>T266476 WP_044650325.1 NZ_CP114312:301363-301638 [Klebsiella variicola]
MEQQVLSLRNKQRHTLEQLFKIPVPQGIKWADIESLIKALGGEIKEGRGSRCKFLLNHSIASFHRPHPSPDTDKGAVESV
RDWLITIGVKP
MEQQVLSLRNKQRHTLEQLFKIPVPQGIKWADIESLIKALGGEIKEGRGSRCKFLLNHSIASFHRPHPSPDTDKGAVESV
RDWLITIGVKP
Download Length: 276 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13313.02 Da Isoelectric Point: 4.4605
>AT266476 WP_004181489.1 NZ_CP114312:301635-301994 [Klebsiella variicola]
MIKPKTPNSMEIAGQPAVINYVPELNAFRGKFLGLSGYCDFVSDSIQGLQQEGEISLQEYLADCHEAGIEPYAHPEKMKT
FTLRYPESFGERLSSAAAEEQVSVNTWILETLNERLKQA
MIKPKTPNSMEIAGQPAVINYVPELNAFRGKFLGLSGYCDFVSDSIQGLQQEGEISLQEYLADCHEAGIEPYAHPEKMKT
FTLRYPESFGERLSSAAAEEQVSVNTWILETLNERLKQA
Download Length: 360 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2V3KJT3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1F2M5Q1 |