Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 58598..59334 Replicon plasmid unnamed1
Accession NZ_CP114309
Organism Klebsiella oxytoca strain 2022CK-00499

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag OEE41_RS28060 Protein ID WP_003026803.1
Coordinates 58852..59334 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag OEE41_RS28055 Protein ID WP_003026799.1
Coordinates 58598..58864 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OEE41_RS28010 (OEE41_28000) 54660..55022 - 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -
OEE41_RS28015 (OEE41_28005) 55072..55422 - 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
OEE41_RS28020 (OEE41_28010) 55780..56049 + 270 WP_004152102.1 hypothetical protein -
OEE41_RS28025 (OEE41_28015) 56037..56612 + 576 WP_004152103.1 hypothetical protein -
OEE41_RS28030 (OEE41_28020) 56643..57137 + 495 WP_004152104.1 DNA-binding protein -
OEE41_RS28035 (OEE41_28025) 57181..57549 + 369 WP_004152105.1 hypothetical protein -
OEE41_RS28040 (OEE41_28030) 57583..57786 + 204 WP_004152106.1 HHA domain-containing protein -
OEE41_RS28045 (OEE41_28035) 57835..58092 + 258 WP_004152107.1 hypothetical protein -
OEE41_RS28050 (OEE41_28040) 58168..58422 + 255 WP_004152108.1 hypothetical protein -
OEE41_RS28055 (OEE41_28045) 58598..58864 + 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
OEE41_RS28060 (OEE41_28050) 58852..59334 + 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
OEE41_RS28065 (OEE41_28055) 59542..60888 + 1347 WP_077253535.1 ISNCY family transposase -
OEE41_RS28070 (OEE41_28060) 60937..61332 + 396 WP_004143398.1 helix-turn-helix domain-containing protein -
OEE41_RS28075 (OEE41_28065) 61480..62645 - 1166 Protein_65 IS3 family transposase -
OEE41_RS28080 (OEE41_28070) 62822..63784 - 963 WP_004152113.1 zinc metalloprotease HtpX -
OEE41_RS28085 (OEE41_28075) 63771..64259 - 489 WP_004152114.1 phosphate-starvation-inducible PsiE family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aph(6)-Id / aph(3'')-Ib - 1..246621 246621


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T266475 WP_003026803.1 NZ_CP114309:58852-59334 [Klebsiella oxytoca]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT266475 WP_003026799.1 NZ_CP114309:58598-58864 [Klebsiella oxytoca]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References