Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX(toxin) |
Location | 4696382..4697201 | Replicon | chromosome |
Accession | NZ_CP114308 | ||
Organism | Klebsiella oxytoca strain 2022CK-00499 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | J5WT09 |
Locus tag | OEE41_RS22105 | Protein ID | WP_004110819.1 |
Coordinates | 4696944..4697201 (-) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | - |
Locus tag | OEE41_RS22100 | Protein ID | WP_142472422.1 |
Coordinates | 4696382..4696933 (-) | Length | 184 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OEE41_RS22070 (OEE41_22060) | 4692403..4692774 | + | 372 | WP_269776307.1 | cyclophilin-like fold protein | - |
OEE41_RS22075 (OEE41_22065) | 4693559..4693900 | + | 342 | Protein_4344 | alcohol dehydrogenase catalytic domain-containing protein | - |
OEE41_RS22080 (OEE41_22070) | 4694154..4694357 | - | 204 | Protein_4345 | VOC family protein | - |
OEE41_RS22085 (OEE41_22075) | 4694357..4694566 | - | 210 | WP_196089984.1 | hypothetical protein | - |
OEE41_RS22090 (OEE41_22080) | 4694736..4695500 | - | 765 | WP_227499114.1 | class I SAM-dependent methyltransferase | - |
OEE41_RS22095 (OEE41_22085) | 4695894..4696268 | - | 375 | Protein_4348 | class I SAM-dependent methyltransferase | - |
OEE41_RS22100 (OEE41_22090) | 4696382..4696933 | - | 552 | WP_142472422.1 | N-acetyltransferase | Antitoxin |
OEE41_RS22105 (OEE41_22095) | 4696944..4697201 | - | 258 | WP_004110819.1 | YjhX family toxin | Toxin |
OEE41_RS22110 (OEE41_22100) | 4697783..4698967 | + | 1185 | WP_004099225.1 | mannonate dehydratase | - |
OEE41_RS22115 (OEE41_22105) | 4699042..4700517 | + | 1476 | WP_004110817.1 | fructuronate reductase | - |
OEE41_RS22120 (OEE41_22110) | 4700653..4701429 | + | 777 | WP_004099223.1 | Uxu operon transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9552.07 Da Isoelectric Point: 11.1381
>T266474 WP_004110819.1 NZ_CP114308:c4697201-4696944 [Klebsiella oxytoca]
MNLSRQEQRTLHVLAKGGRIAHIRDASGRVTSVECYSREGLLLSDCTLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRA
QLDNR
MNLSRQEQRTLHVLAKGGRIAHIRDASGRVTSVECYSREGLLLSDCTLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 184 a.a. Molecular weight: 20213.02 Da Isoelectric Point: 6.7181
>AT266474 WP_142472422.1 NZ_CP114308:c4696933-4696382 [Klebsiella oxytoca]
MTNHNFTFHITSERDADDIREVETRAFGFSKEADLVADLLNDESAHPSLSLLAKHNGKAVGHILFTLATFKGESDSPMMH
ILAPLAVVPEYQGVGVGGLLIQRGIEHLKAAGSEAVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMLQRLSS
RPLGRTGQIQCARALMKPEHWRE
MTNHNFTFHITSERDADDIREVETRAFGFSKEADLVADLLNDESAHPSLSLLAKHNGKAVGHILFTLATFKGESDSPMMH
ILAPLAVVPEYQGVGVGGLLIQRGIEHLKAAGSEAVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMLQRLSS
RPLGRTGQIQCARALMKPEHWRE
Download Length: 552 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|