Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 926179..926836 | Replicon | chromosome |
| Accession | NZ_CP114308 | ||
| Organism | Klebsiella oxytoca strain 2022CK-00499 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A181X6I0 |
| Locus tag | OEE41_RS04430 | Protein ID | WP_004105559.1 |
| Coordinates | 926426..926836 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A285B945 |
| Locus tag | OEE41_RS04425 | Protein ID | WP_004105561.1 |
| Coordinates | 926179..926445 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OEE41_RS04410 (OEE41_04410) | 921432..921857 | - | 426 | WP_004124962.1 | PTS sugar transporter subunit IIA | - |
| OEE41_RS04415 (OEE41_04415) | 921978..924776 | - | 2799 | WP_210614839.1 | transcriptional regulator DagR | - |
| OEE41_RS04420 (OEE41_04420) | 924952..925935 | - | 984 | WP_004115279.1 | tRNA-modifying protein YgfZ | - |
| OEE41_RS04425 (OEE41_04425) | 926179..926445 | + | 267 | WP_004105561.1 | FAD assembly factor SdhE | Antitoxin |
| OEE41_RS04430 (OEE41_04430) | 926426..926836 | + | 411 | WP_004105559.1 | protein YgfX | Toxin |
| OEE41_RS04435 (OEE41_04435) | 926845..927366 | - | 522 | WP_210614837.1 | flavodoxin FldB | - |
| OEE41_RS04440 (OEE41_04440) | 927488..928384 | + | 897 | WP_004105555.1 | site-specific tyrosine recombinase XerD | - |
| OEE41_RS04445 (OEE41_04445) | 928407..929120 | + | 714 | WP_004105554.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| OEE41_RS04450 (OEE41_04450) | 929126..930859 | + | 1734 | WP_004105553.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16061.83 Da Isoelectric Point: 10.9455
>T266468 WP_004105559.1 NZ_CP114308:926426-926836 [Klebsiella oxytoca]
VVLWQSDLRISWRAQWFSLLMHGVVAALVLVLPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWDIVGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLQKPTQD
VVLWQSDLRISWRAQWFSLLMHGVVAALVLVLPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWDIVGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLQKPTQD
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A181X6I0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A285B945 |