Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX(toxin) |
Location | 4584396..4585215 | Replicon | chromosome |
Accession | NZ_CP114305 | ||
Organism | Klebsiella oxytoca strain 2022CK-00498 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | J5WT09 |
Locus tag | OGU21_RS21620 | Protein ID | WP_004110819.1 |
Coordinates | 4584958..4585215 (-) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | - |
Locus tag | OGU21_RS21615 | Protein ID | WP_023329286.1 |
Coordinates | 4584396..4584947 (-) | Length | 184 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OGU21_RS21590 (OGU21_21590) | 4579466..4580014 | - | 549 | WP_004099233.1 | type 1 fimbrial major subunit FimA | - |
OGU21_RS21595 (OGU21_21595) | 4580387..4581154 | + | 768 | WP_004099232.1 | winged helix-turn-helix domain-containing protein | - |
OGU21_RS21600 (OGU21_21600) | 4581782..4582459 | + | 678 | WP_023329288.1 | sigma-70 region 4 domain-containing protein | - |
OGU21_RS21605 (OGU21_21605) | 4582750..4583514 | - | 765 | WP_224227635.1 | class I SAM-dependent methyltransferase | - |
OGU21_RS21610 (OGU21_21610) | 4583890..4584282 | - | 393 | Protein_4250 | class I SAM-dependent methyltransferase | - |
OGU21_RS21615 (OGU21_21615) | 4584396..4584947 | - | 552 | WP_023329286.1 | N-acetyltransferase | Antitoxin |
OGU21_RS21620 (OGU21_21620) | 4584958..4585215 | - | 258 | WP_004110819.1 | YjhX family toxin | Toxin |
OGU21_RS21625 (OGU21_21625) | 4585797..4586981 | + | 1185 | WP_004099225.1 | mannonate dehydratase | - |
OGU21_RS21630 (OGU21_21630) | 4587056..4588531 | + | 1476 | WP_047720344.1 | fructuronate reductase | - |
OGU21_RS21635 (OGU21_21635) | 4588667..4589443 | + | 777 | WP_004099223.1 | Uxu operon transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9552.07 Da Isoelectric Point: 11.1381
>T266465 WP_004110819.1 NZ_CP114305:c4585215-4584958 [Klebsiella oxytoca]
MNLSRQEQRTLHVLAKGGRIAHIRDASGRVTSVECYSREGLLLSDCTLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRA
QLDNR
MNLSRQEQRTLHVLAKGGRIAHIRDASGRVTSVECYSREGLLLSDCTLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 184 a.a. Molecular weight: 20125.00 Da Isoelectric Point: 7.0635
>AT266465 WP_023329286.1 NZ_CP114305:c4584947-4584396 [Klebsiella oxytoca]
MTNHNFTFHITSERDAADIREVETRAFGFSKEADLVAALLNDESAHPSLSLLAKHNGKAVGHILFTLATFKGESDSPMMH
ILAPLAVVPEYQGVGVGGLLIQRGIEHLKAAGSEAVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMLQRLSS
RPLGRTGQIQCARALMKPEHWRE
MTNHNFTFHITSERDAADIREVETRAFGFSKEADLVAALLNDESAHPSLSLLAKHNGKAVGHILFTLATFKGESDSPMMH
ILAPLAVVPEYQGVGVGGLLIQRGIEHLKAAGSEAVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMLQRLSS
RPLGRTGQIQCARALMKPEHWRE
Download Length: 552 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|