Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4345637..4346256 | Replicon | chromosome |
Accession | NZ_CP114305 | ||
Organism | Klebsiella oxytoca strain 2022CK-00498 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H3N9D8 |
Locus tag | OGU21_RS20490 | Protein ID | WP_004099646.1 |
Coordinates | 4346038..4346256 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | - |
Locus tag | OGU21_RS20485 | Protein ID | WP_004099648.1 |
Coordinates | 4345637..4346011 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OGU21_RS20475 (OGU21_20475) | 4340793..4341986 | + | 1194 | WP_004111040.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
OGU21_RS20480 (OGU21_20480) | 4342009..4345155 | + | 3147 | WP_004099650.1 | multidrug efflux RND transporter permease subunit AcrB | - |
OGU21_RS20485 (OGU21_20485) | 4345637..4346011 | + | 375 | WP_004099648.1 | Hha toxicity modulator TomB | Antitoxin |
OGU21_RS20490 (OGU21_20490) | 4346038..4346256 | + | 219 | WP_004099646.1 | HHA domain-containing protein | Toxin |
OGU21_RS20495 (OGU21_20495) | 4346417..4346983 | + | 567 | WP_004099644.1 | maltose O-acetyltransferase | - |
OGU21_RS20500 (OGU21_20500) | 4346952..4347089 | - | 138 | WP_224226720.1 | hypothetical protein | - |
OGU21_RS20505 (OGU21_20505) | 4347120..4347590 | + | 471 | WP_004111038.1 | YlaC family protein | - |
OGU21_RS20510 (OGU21_20510) | 4347565..4349019 | - | 1455 | WP_070557208.1 | PLP-dependent aminotransferase family protein | - |
OGU21_RS20515 (OGU21_20515) | 4349122..4349820 | + | 699 | WP_004099639.1 | GNAT family protein | - |
OGU21_RS20520 (OGU21_20520) | 4349817..4349957 | - | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
OGU21_RS20525 (OGU21_20525) | 4349957..4350220 | - | 264 | WP_004099638.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8640.05 Da Isoelectric Point: 8.9008
>T266464 WP_004099646.1 NZ_CP114305:4346038-4346256 [Klebsiella oxytoca]
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14350.09 Da Isoelectric Point: 4.8989
>AT266464 WP_004099648.1 NZ_CP114305:4345637-4346011 [Klebsiella oxytoca]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLVTQLDEYL
DDTFVLFSNYGINTADLQKWRKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLVTQLDEYL
DDTFVLFSNYGINTADLQKWRKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|