Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yfjZ-ypjF/CbtA-CbeA
Location 959133..959818 Replicon chromosome
Accession NZ_CP114305
Organism Klebsiella oxytoca strain 2022CK-00498

Toxin (Protein)


Gene name ypjF Uniprot ID A0A6N2Y1K0
Locus tag OGU21_RS04650 Protein ID WP_063415422.1
Coordinates 959495..959818 (+) Length 108 a.a.

Antitoxin (Protein)


Gene name yfjZ Uniprot ID A0A6N2Y013
Locus tag OGU21_RS04645 Protein ID WP_063415420.1
Coordinates 959133..959474 (+) Length 114 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OGU21_RS04610 (OGU21_04615) 954283..955158 + 876 WP_047037247.1 GTPase family protein -
OGU21_RS04615 (OGU21_04620) 955402..956118 + 717 WP_156529647.1 WYL domain-containing protein -
OGU21_RS04620 (OGU21_04625) 956154..956606 + 453 WP_063415412.1 hypothetical protein -
OGU21_RS04625 (OGU21_04630) 956679..957152 + 474 WP_156529646.1 hypothetical protein -
OGU21_RS04630 (OGU21_04635) 957272..958093 + 822 WP_063415416.1 DUF932 domain-containing protein -
OGU21_RS04635 (OGU21_04640) 958124..958567 + 444 WP_156529645.1 antirestriction protein -
OGU21_RS04640 (OGU21_04645) 958580..959122 + 543 WP_063415418.1 DNA repair protein RadC -
OGU21_RS04645 (OGU21_04650) 959133..959474 + 342 WP_063415420.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
OGU21_RS04650 (OGU21_04655) 959495..959818 + 324 WP_063415422.1 TA system toxin CbtA family protein Toxin
OGU21_RS04655 (OGU21_04660) 960375..960734 - 360 WP_004105483.1 DUF4156 domain-containing protein -
OGU21_RS04660 (OGU21_04665) 960976..961512 - 537 WP_004105482.1 Ail/Lom family outer membrane beta-barrel protein -
OGU21_RS04665 (OGU21_04670) 961722..962210 - 489 WP_004105480.1 hypothetical protein -
OGU21_RS04670 (OGU21_04675) 962183..962920 - 738 WP_269776745.1 response regulator -
OGU21_RS04675 (OGU21_04680) 962977..964539 - 1563 WP_083307745.1 EAL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 909242..962920 53678


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-107)

Antitoxin

Antitoxin CbeA

(13-112)


Sequences

Toxin        


Download         Length: 108 a.a.        Molecular weight: 12482.52 Da        Isoelectric Point: 7.1331

>T266459 WP_063415422.1 NZ_CP114305:959495-959818 [Klebsiella oxytoca]
MKFLPTTNMRAVKPCLSPVTIWQMLLSRLLEQHYGLTLNDTPFCDETVIQEHIDAGITLANAINFLVEKYELGRIDRRGF
SWQEQTPYLTIIDIMRARRDLGLMNRN

Download         Length: 324 bp

Antitoxin


Download         Length: 114 a.a.        Molecular weight: 12821.46 Da        Isoelectric Point: 6.6253

>AT266459 WP_063415420.1 NZ_CP114305:959133-959474 [Klebsiella oxytoca]
MKSTDSENDSFLKWGLNRNVTPCFGARLVQEGNRLHYLADRASFTGKFSEAECLKLDVAFPHFISQMESMLTTGEMNPRH
AHCVTLYHNGFTCEADTLGSYGYVYIAIYPTQR

Download         Length: 342 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6N2Y1K0

Antitoxin

Source ID Structure
AlphaFold DB A0A6N2Y013

References