Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 889895..890552 | Replicon | chromosome |
Accession | NZ_CP114305 | ||
Organism | Klebsiella oxytoca strain 2022CK-00498 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A181X6I0 |
Locus tag | OGU21_RS04300 | Protein ID | WP_004105559.1 |
Coordinates | 890142..890552 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A285B945 |
Locus tag | OGU21_RS04295 | Protein ID | WP_004105561.1 |
Coordinates | 889895..890161 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OGU21_RS04270 (OGU21_04275) | 885074..886507 | - | 1434 | WP_004105576.1 | 6-phospho-beta-glucosidase | - |
OGU21_RS04275 (OGU21_04280) | 886628..887356 | - | 729 | WP_064352017.1 | MurR/RpiR family transcriptional regulator | - |
OGU21_RS04280 (OGU21_04285) | 887407..887718 | + | 312 | WP_017145456.1 | N(4)-acetylcytidine aminohydrolase | - |
OGU21_RS04285 (OGU21_04290) | 887880..888539 | + | 660 | WP_064344096.1 | hemolysin III family protein | - |
OGU21_RS04290 (OGU21_04295) | 888668..889651 | - | 984 | WP_224261472.1 | tRNA-modifying protein YgfZ | - |
OGU21_RS04295 (OGU21_04300) | 889895..890161 | + | 267 | WP_004105561.1 | FAD assembly factor SdhE | Antitoxin |
OGU21_RS04300 (OGU21_04305) | 890142..890552 | + | 411 | WP_004105559.1 | protein YgfX | Toxin |
OGU21_RS04305 (OGU21_04310) | 890561..891082 | - | 522 | WP_004105557.1 | flavodoxin FldB | - |
OGU21_RS04310 (OGU21_04315) | 891204..892100 | + | 897 | WP_004105555.1 | site-specific tyrosine recombinase XerD | - |
OGU21_RS04315 (OGU21_04320) | 892123..892836 | + | 714 | WP_004105554.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
OGU21_RS04320 (OGU21_04325) | 892842..894575 | + | 1734 | WP_024274698.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16061.83 Da Isoelectric Point: 10.9455
>T266458 WP_004105559.1 NZ_CP114305:890142-890552 [Klebsiella oxytoca]
VVLWQSDLRISWRAQWFSLLMHGVVAALVLVLPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWDIVGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLQKPTQD
VVLWQSDLRISWRAQWFSLLMHGVVAALVLVLPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWDIVGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLQKPTQD
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A181X6I0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A285B945 |