Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 673391..673983 | Replicon | chromosome |
| Accession | NZ_CP114305 | ||
| Organism | Klebsiella oxytoca strain 2022CK-00498 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | A0A7H4PHG5 |
| Locus tag | OGU21_RS03265 | Protein ID | WP_004105955.1 |
| Coordinates | 673609..673983 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | A0A2J4YM08 |
| Locus tag | OGU21_RS03260 | Protein ID | WP_004105957.1 |
| Coordinates | 673391..673612 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OGU21_RS03240 (OGU21_03245) | 668952..669506 | + | 555 | WP_004105965.1 | YgjV family protein | - |
| OGU21_RS03245 (OGU21_03250) | 669521..670768 | - | 1248 | WP_004105963.1 | serine/threonine transporter SstT | - |
| OGU21_RS03250 (OGU21_03255) | 671023..671991 | - | 969 | WP_004115718.1 | TerC family protein | - |
| OGU21_RS03255 (OGU21_03260) | 672242..673231 | - | 990 | WP_070556310.1 | Gfo/Idh/MocA family oxidoreductase | - |
| OGU21_RS03260 (OGU21_03265) | 673391..673612 | + | 222 | WP_004105957.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| OGU21_RS03265 (OGU21_03270) | 673609..673983 | + | 375 | WP_004105955.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| OGU21_RS03270 (OGU21_03275) | 673963..674466 | - | 504 | WP_070556312.1 | M48 family metallopeptidase | - |
| OGU21_RS03275 (OGU21_03280) | 674545..676188 | - | 1644 | WP_004115710.1 | glycoside hydrolase family 43 protein | - |
| OGU21_RS03280 (OGU21_03285) | 676317..677183 | - | 867 | WP_004105950.1 | AraC family transcriptional regulator | - |
| OGU21_RS03285 (OGU21_03290) | 677291..678634 | + | 1344 | WP_004105949.1 | glycoside-pentoside-hexuronide (GPH):cation symporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13895.93 Da Isoelectric Point: 6.0769
>T266457 WP_004105955.1 NZ_CP114305:673609-673983 [Klebsiella oxytoca]
MKWVSASEVIAFHDRILQHLPGVKGMSDPGRAEAIIYRVQNRFHYEGVNDIFELAATYWVAIARGHIFNDGNKRTAFFIT
MTFLARNGYLIADEDTRLEELTVLAATGEATVVVLADALRQLAL
MKWVSASEVIAFHDRILQHLPGVKGMSDPGRAEAIIYRVQNRFHYEGVNDIFELAATYWVAIARGHIFNDGNKRTAFFIT
MTFLARNGYLIADEDTRLEELTVLAATGEATVVVLADALRQLAL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7H4PHG5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J4YM08 |