Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 86780..87585 Replicon chromosome
Accession NZ_CP114305
Organism Klebsiella oxytoca strain 2022CK-00498

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag OGU21_RS00435 Protein ID WP_108704383.1
Coordinates 86780..87169 (-) Length 130 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag OGU21_RS00440 Protein ID WP_156529788.1
Coordinates 87226..87585 (-) Length 120 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OGU21_RS00400 (OGU21_00400) 82059..82361 - 303 WP_049127699.1 putative quinol monooxygenase -
OGU21_RS00405 (OGU21_00405) 82363..83370 - 1008 WP_017145218.1 zinc-binding alcohol dehydrogenase family protein -
OGU21_RS00410 (OGU21_00410) 83483..83950 - 468 WP_064344103.1 DUF3237 domain-containing protein -
OGU21_RS00415 (OGU21_00415) 84151..84606 + 456 WP_004106993.1 helix-turn-helix domain-containing protein -
OGU21_RS00420 (OGU21_00420) 84606..85181 + 576 WP_017145221.1 PIN domain-containing protein -
OGU21_RS00425 (OGU21_00425) 85460..85582 + 123 WP_094298907.1 hypothetical protein -
OGU21_RS00430 (OGU21_00430) 85848..86693 - 846 WP_156529787.1 DUF4942 domain-containing protein -
OGU21_RS00435 (OGU21_00435) 86780..87169 - 390 WP_108704383.1 TA system toxin CbtA family protein Toxin
OGU21_RS00440 (OGU21_00440) 87226..87585 - 360 WP_156529788.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
OGU21_RS00445 (OGU21_00445) 87610..87831 - 222 WP_108704385.1 DUF987 family protein -
OGU21_RS00450 (OGU21_00450) 87845..88324 - 480 WP_004109365.1 DNA repair protein RadC -
OGU21_RS00455 (OGU21_00455) 88336..88785 - 450 WP_156529789.1 antirestriction protein -
OGU21_RS00460 (OGU21_00460) 88818..89639 - 822 WP_156529790.1 DUF932 domain-containing protein -
OGU21_RS00465 (OGU21_00465) 89975..90925 - 951 WP_108704388.1 hypothetical protein -
OGU21_RS00470 (OGU21_00470) 91475..92119 + 645 WP_228160427.1 inovirus Gp2 family protein -
OGU21_RS00475 (OGU21_00475) 92232..92450 + 219 WP_108705052.1 AlpA family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-111)

Antitoxin

Antitoxin CbeA

(15-114)


Sequences

Toxin        


Download         Length: 130 a.a.        Molecular weight: 14272.25 Da        Isoelectric Point: 9.5904

>T266456 WP_108704383.1 NZ_CP114305:c87169-86780 [Klebsiella oxytoca]
MQTKSSSLMRAASSRPSPVDVWQALLTSLLAQHYSLTLSDTPFSDEQVIQQHIDAGISLADALNFIVEKYELVRTDRPGF
SIIEQSPFITAIDILRARKVTGLMNRGTYKEVTAITRGQHPQANASGKR

Download         Length: 390 bp

Antitoxin


Download         Length: 120 a.a.        Molecular weight: 13393.19 Da        Isoelectric Point: 6.7438

>AT266456 WP_156529788.1 NZ_CP114305:c87585-87226 [Klebsiella oxytoca]
MSKNTTITTHDISEPWWGLRRSVSPCFGARLVQEGNRLHYLADRANFDGKFCDADLRHLDQSFPVLMKQLELMLTSGELN
PRHQHGVTLYAKGLACEADTLGSHGYVYIAIYPTPVTTE

Download         Length: 360 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References