Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 86780..87585 | Replicon | chromosome |
| Accession | NZ_CP114305 | ||
| Organism | Klebsiella oxytoca strain 2022CK-00498 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | OGU21_RS00435 | Protein ID | WP_108704383.1 |
| Coordinates | 86780..87169 (-) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | OGU21_RS00440 | Protein ID | WP_156529788.1 |
| Coordinates | 87226..87585 (-) | Length | 120 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OGU21_RS00400 (OGU21_00400) | 82059..82361 | - | 303 | WP_049127699.1 | putative quinol monooxygenase | - |
| OGU21_RS00405 (OGU21_00405) | 82363..83370 | - | 1008 | WP_017145218.1 | zinc-binding alcohol dehydrogenase family protein | - |
| OGU21_RS00410 (OGU21_00410) | 83483..83950 | - | 468 | WP_064344103.1 | DUF3237 domain-containing protein | - |
| OGU21_RS00415 (OGU21_00415) | 84151..84606 | + | 456 | WP_004106993.1 | helix-turn-helix domain-containing protein | - |
| OGU21_RS00420 (OGU21_00420) | 84606..85181 | + | 576 | WP_017145221.1 | PIN domain-containing protein | - |
| OGU21_RS00425 (OGU21_00425) | 85460..85582 | + | 123 | WP_094298907.1 | hypothetical protein | - |
| OGU21_RS00430 (OGU21_00430) | 85848..86693 | - | 846 | WP_156529787.1 | DUF4942 domain-containing protein | - |
| OGU21_RS00435 (OGU21_00435) | 86780..87169 | - | 390 | WP_108704383.1 | TA system toxin CbtA family protein | Toxin |
| OGU21_RS00440 (OGU21_00440) | 87226..87585 | - | 360 | WP_156529788.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| OGU21_RS00445 (OGU21_00445) | 87610..87831 | - | 222 | WP_108704385.1 | DUF987 family protein | - |
| OGU21_RS00450 (OGU21_00450) | 87845..88324 | - | 480 | WP_004109365.1 | DNA repair protein RadC | - |
| OGU21_RS00455 (OGU21_00455) | 88336..88785 | - | 450 | WP_156529789.1 | antirestriction protein | - |
| OGU21_RS00460 (OGU21_00460) | 88818..89639 | - | 822 | WP_156529790.1 | DUF932 domain-containing protein | - |
| OGU21_RS00465 (OGU21_00465) | 89975..90925 | - | 951 | WP_108704388.1 | hypothetical protein | - |
| OGU21_RS00470 (OGU21_00470) | 91475..92119 | + | 645 | WP_228160427.1 | inovirus Gp2 family protein | - |
| OGU21_RS00475 (OGU21_00475) | 92232..92450 | + | 219 | WP_108705052.1 | AlpA family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14272.25 Da Isoelectric Point: 9.5904
>T266456 WP_108704383.1 NZ_CP114305:c87169-86780 [Klebsiella oxytoca]
MQTKSSSLMRAASSRPSPVDVWQALLTSLLAQHYSLTLSDTPFSDEQVIQQHIDAGISLADALNFIVEKYELVRTDRPGF
SIIEQSPFITAIDILRARKVTGLMNRGTYKEVTAITRGQHPQANASGKR
MQTKSSSLMRAASSRPSPVDVWQALLTSLLAQHYSLTLSDTPFSDEQVIQQHIDAGISLADALNFIVEKYELVRTDRPGF
SIIEQSPFITAIDILRARKVTGLMNRGTYKEVTAITRGQHPQANASGKR
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|