Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 60869..61416 | Replicon | chromosome |
Accession | NZ_CP114305 | ||
Organism | Klebsiella oxytoca strain 2022CK-00498 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | - |
Locus tag | OGU21_RS00300 | Protein ID | WP_070556473.1 |
Coordinates | 60869..61177 (-) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | - |
Locus tag | OGU21_RS00305 | Protein ID | WP_064344020.1 |
Coordinates | 61180..61416 (-) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OGU21_RS00275 (OGU21_00275) | 56773..57084 | - | 312 | WP_004107048.1 | PTS sugar transporter subunit IIB | - |
OGU21_RS00280 (OGU21_00280) | 57379..58320 | + | 942 | WP_004107045.1 | LacI family DNA-binding transcriptional regulator | - |
OGU21_RS00285 (OGU21_00285) | 58344..58640 | - | 297 | WP_004116571.1 | YicS family protein | - |
OGU21_RS00290 (OGU21_00290) | 58851..59813 | + | 963 | Protein_57 | Rpn family recombination-promoting nuclease/putative transposase | - |
OGU21_RS00295 (OGU21_00295) | 59817..60719 | - | 903 | WP_004107039.1 | DMT family transporter | - |
OGU21_RS00300 (OGU21_00300) | 60869..61177 | - | 309 | WP_070556473.1 | CcdB family protein | Toxin |
OGU21_RS00305 (OGU21_00305) | 61180..61416 | - | 237 | WP_064344020.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
OGU21_RS00310 (OGU21_00310) | 61522..62955 | - | 1434 | WP_064370664.1 | PTS N-acetylmuramic acid transporter subunit IIBC | - |
OGU21_RS00315 (OGU21_00315) | 62980..63882 | - | 903 | WP_134883454.1 | N-acetylmuramic acid 6-phosphate etherase | - |
OGU21_RS00320 (OGU21_00320) | 64044..65210 | - | 1167 | WP_004107034.1 | multidrug effflux MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 58848..59048 | 200 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11683.48 Da Isoelectric Point: 5.6023
>T266454 WP_070556473.1 NZ_CP114305:c61177-60869 [Klebsiella oxytoca]
MQYYVYKNTGRIAAYPYLLDVQSDIIGERNTRVVIPLFPLKNYKGPLADRLTPLVTVEGEEYVVMTHELASIPHRVLGEE
VCNLNHQREVVKASMDFLFDGI
MQYYVYKNTGRIAAYPYLLDVQSDIIGERNTRVVIPLFPLKNYKGPLADRLTPLVTVEGEEYVVMTHELASIPHRVLGEE
VCNLNHQREVVKASMDFLFDGI
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|