Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH |
Location | 1812509..1813187 | Replicon | chromosome |
Accession | NZ_CP114281 | ||
Organism | Gallibacterium anatis strain ESV200 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | CF557_RS08530 | Protein ID | WP_094872202.1 |
Coordinates | 1812804..1813187 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | CF557_RS08525 | Protein ID | WP_013746372.1 |
Coordinates | 1812509..1812811 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CF557_RS08500 (CF557_08500) | 1807874..1808593 | + | 720 | WP_039162542.1 | DUF969 domain-containing protein | - |
CF557_RS08505 (CF557_08505) | 1808593..1809576 | + | 984 | WP_021462390.1 | DUF979 domain-containing protein | - |
CF557_RS08510 (CF557_08510) | 1809586..1810578 | + | 993 | WP_094872206.1 | DUF2891 domain-containing protein | - |
CF557_RS08515 (CF557_08515) | 1810989..1811705 | + | 717 | WP_039169016.1 | amino acid ABC transporter permease | - |
CF557_RS08520 (CF557_08520) | 1811708..1812451 | + | 744 | WP_179256211.1 | amino acid ABC transporter ATP-binding protein | - |
CF557_RS08525 (CF557_08525) | 1812509..1812811 | - | 303 | WP_013746372.1 | DNA-binding transcriptional regulator | Antitoxin |
CF557_RS08530 (CF557_08530) | 1812804..1813187 | - | 384 | WP_094872202.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
CF557_RS08535 (CF557_08535) | 1813387..1813665 | + | 279 | WP_039089572.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
CF557_RS08540 (CF557_08540) | 1813676..1813972 | + | 297 | WP_018346511.1 | HigA family addiction module antitoxin | - |
CF557_RS08545 (CF557_08545) | 1814003..1814590 | - | 588 | WP_018346512.1 | Fic family protein | - |
CF557_RS08550 (CF557_08550) | 1814559..1814750 | - | 192 | WP_013746378.1 | antitoxin VbhA family protein | - |
CF557_RS08555 (CF557_08555) | 1815235..1816065 | - | 831 | Protein_1664 | IS3 family transposase | - |
CF557_RS08560 (CF557_08560) | 1816068..1816373 | - | 306 | WP_013744838.1 | IS3 family transposase | - |
CF557_RS08565 (CF557_08565) | 1816741..1818120 | - | 1380 | WP_094872855.1 | cysteine--tRNA ligase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14285.31 Da Isoelectric Point: 8.9256
>T266451 WP_094872202.1 NZ_CP114281:c1813187-1812804 [Gallibacterium anatis]
MRIFKTKAFNKFALKNGIPDSELINAITRAEQGLIDADLGSNIIKQRIARKGQVRSGGFRSFIFYCIQNNSYFVAGISKN
DRENISSQELAALKALAREYTRLTAKQIEAQIENGLFIEILPEAEDE
MRIFKTKAFNKFALKNGIPDSELINAITRAEQGLIDADLGSNIIKQRIARKGQVRSGGFRSFIFYCIQNNSYFVAGISKN
DRENISSQELAALKALAREYTRLTAKQIEAQIENGLFIEILPEAEDE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|