Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 1243732..1244378 | Replicon | chromosome |
| Accession | NZ_CP114281 | ||
| Organism | Gallibacterium anatis strain ESV200 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | CF557_RS05865 | Protein ID | WP_094871717.1 |
| Coordinates | 1243732..1244139 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A0A2Z0K5 |
| Locus tag | CF557_RS05870 | Protein ID | WP_021461268.1 |
| Coordinates | 1244139..1244378 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CF557_RS05845 (CF557_05845) | 1238820..1238981 | - | 162 | WP_179256201.1 | hypothetical protein | - |
| CF557_RS05850 (CF557_05850) | 1239182..1240300 | - | 1119 | WP_094871715.1 | iron-sulfur cluster carrier protein ApbC | - |
| CF557_RS05855 (CF557_05855) | 1240498..1242543 | + | 2046 | WP_039148672.1 | methionine--tRNA ligase | - |
| CF557_RS05860 (CF557_05860) | 1242628..1243632 | + | 1005 | WP_013746892.1 | 16S rRNA (guanine(1207)-N(2))-methyltransferase RsmC | - |
| CF557_RS05865 (CF557_05865) | 1243732..1244139 | - | 408 | WP_094871717.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| CF557_RS05870 (CF557_05870) | 1244139..1244378 | - | 240 | WP_021461268.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| CF557_RS05875 (CF557_05875) | 1244670..1245665 | + | 996 | WP_094871720.1 | thiamine ABC transporter substrate binding subunit | - |
| CF557_RS05880 (CF557_05880) | 1245641..1247263 | + | 1623 | WP_094871722.1 | thiamine/thiamine pyrophosphate ABC transporter permease | - |
| CF557_RS05885 (CF557_05885) | 1247250..1247912 | + | 663 | WP_094871724.1 | thiamine ABC transporter ATP-binding protein | - |
| CF557_RS05890 (CF557_05890) | 1247952..1248962 | + | 1011 | WP_039083518.1 | biotin synthase BioB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15105.64 Da Isoelectric Point: 7.8732
>T266450 WP_094871717.1 NZ_CP114281:c1244139-1243732 [Gallibacterium anatis]
MLKYMLDTNIVIFTIKNKPPHLLPLFNENQSMLCISSITLMELVYGAEKSKKTAQNLAVIESFCARLAVLDYDEAAAYHS
GQIRAELAKIRQPIGSYDAMIAGHARSLGLTVVTNNMNEFSRVEGLRVIDWSKPM
MLKYMLDTNIVIFTIKNKPPHLLPLFNENQSMLCISSITLMELVYGAEKSKKTAQNLAVIESFCARLAVLDYDEAAAYHS
GQIRAELAKIRQPIGSYDAMIAGHARSLGLTVVTNNMNEFSRVEGLRVIDWSKPM
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|