Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-DnaT |
Location | 1236531..1237080 | Replicon | chromosome |
Accession | NZ_CP114281 | ||
Organism | Gallibacterium anatis strain ESV200 |
Toxin (Protein)
Gene name | relE | Uniprot ID | F4HEY3 |
Locus tag | CF557_RS05830 | Protein ID | WP_013746900.1 |
Coordinates | 1236781..1237080 (+) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0A2YRY5 |
Locus tag | CF557_RS05825 | Protein ID | WP_039085646.1 |
Coordinates | 1236531..1236791 (+) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CF557_RS05810 (CF557_05810) | 1231807..1232871 | - | 1065 | WP_269445961.1 | dTDP-glucose 4,6-dehydratase | - |
CF557_RS05815 (CF557_05815) | 1233186..1234613 | + | 1428 | WP_269445962.1 | undecaprenyl-phosphate galactose phosphotransferase WbaP | - |
CF557_RS05820 (CF557_05820) | 1234686..1236245 | - | 1560 | WP_094871709.1 | Fic family protein | - |
CF557_RS05825 (CF557_05825) | 1236531..1236791 | + | 261 | WP_039085646.1 | stability protein StbD | Antitoxin |
CF557_RS05830 (CF557_05830) | 1236781..1237080 | + | 300 | WP_013746900.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
CF557_RS05835 (CF557_05835) | 1237207..1237425 | + | 219 | WP_013746899.1 | translation initiation factor IF-1 | - |
CF557_RS05840 (CF557_05840) | 1237511..1238779 | + | 1269 | WP_094871712.1 | O-antigen ligase | - |
CF557_RS05845 (CF557_05845) | 1238820..1238981 | - | 162 | WP_179256201.1 | hypothetical protein | - |
CF557_RS05850 (CF557_05850) | 1239182..1240300 | - | 1119 | WP_094871715.1 | iron-sulfur cluster carrier protein ApbC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11752.61 Da Isoelectric Point: 10.4596
>T266449 WP_013746900.1 NZ_CP114281:1236781-1237080 [Gallibacterium anatis]
MTYSLQFHEKALKEWKKLDETTRSQLKKKLAERLQNPHIQADRLSGFSNPTYKIKLRSIGYRLVYEVNDDIITVFVLSVG
KRNKLQAYINAHHRAEKMY
MTYSLQFHEKALKEWKKLDETTRSQLKKKLAERLQNPHIQADRLSGFSNPTYKIKLRSIGYRLVYEVNDDIITVFVLSVG
KRNKLQAYINAHHRAEKMY
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | F4HEY3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0A2YRY5 |