Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 1196397..1196942 | Replicon | chromosome |
| Accession | NZ_CP114281 | ||
| Organism | Gallibacterium anatis strain ESV200 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | F4HF99 |
| Locus tag | CF557_RS05635 | Protein ID | WP_013746939.1 |
| Coordinates | 1196397..1196684 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A0A2ZZB6 |
| Locus tag | CF557_RS05640 | Protein ID | WP_039087491.1 |
| Coordinates | 1196694..1196942 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CF557_RS05605 (CF557_05605) | 1191670..1192596 | + | 927 | WP_039083772.1 | phosphoserine phosphatase | - |
| CF557_RS05610 (CF557_05610) | 1192609..1193100 | + | 492 | WP_013746944.1 | YajQ family cyclic di-GMP-binding protein | - |
| CF557_RS05615 (CF557_05615) | 1193122..1193289 | + | 168 | WP_018345760.1 | DUF5363 family protein | - |
| CF557_RS05620 (CF557_05620) | 1193374..1195389 | + | 2016 | WP_094873352.1 | NAD-dependent DNA ligase LigA | - |
| CF557_RS05625 (CF557_05625) | 1195594..1195860 | + | 267 | WP_018345762.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| CF557_RS05630 (CF557_05630) | 1195860..1196213 | + | 354 | WP_094873350.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| CF557_RS05635 (CF557_05635) | 1196397..1196684 | - | 288 | WP_013746939.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| CF557_RS05640 (CF557_05640) | 1196694..1196942 | - | 249 | WP_039087491.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| CF557_RS05645 (CF557_05645) | 1197059..1198162 | - | 1104 | WP_094873348.1 | porin | - |
| CF557_RS05650 (CF557_05650) | 1198928..1199989 | + | 1062 | WP_094873347.1 | porin | - |
| CF557_RS05655 (CF557_05655) | 1200296..1201426 | - | 1131 | WP_094873345.1 | porin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11026.94 Da Isoelectric Point: 10.4262
>T266448 WP_013746939.1 NZ_CP114281:c1196684-1196397 [Gallibacterium anatis]
MAYAIKVHSDFVAELNKLDSTIKNQLRKKLEKVVHNPHIPKNRLSGELHNCYKIKLRKAGVRLVYQVNDDEIYILLLTVG
KREAKQVYNTALNRV
MAYAIKVHSDFVAELNKLDSTIKNQLRKKLEKVVHNPHIPKNRLSGELHNCYKIKLRKAGVRLVYQVNDDEIYILLLTVG
KREAKQVYNTALNRV
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | F4HF99 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0A2ZZB6 |