Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 832525..833147 | Replicon | chromosome |
Accession | NZ_CP114281 | ||
Organism | Gallibacterium anatis strain ESV200 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A0A2YI69 |
Locus tag | CF557_RS03985 | Protein ID | WP_039095731.1 |
Coordinates | 832525..832707 (+) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A0A2YMS8 |
Locus tag | CF557_RS03990 | Protein ID | WP_039095729.1 |
Coordinates | 832737..833147 (+) | Length | 137 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CF557_RS03965 (CF557_03965) | 830022..831038 | + | 1017 | WP_094873405.1 | GTP 3',8-cyclase MoaA | - |
CF557_RS03970 (CF557_03970) | 831061..831543 | + | 483 | WP_013747232.1 | cyclic pyranopterin monophosphate synthase MoaC | - |
CF557_RS03975 (CF557_03975) | 831540..831785 | + | 246 | WP_021461514.1 | molybdopterin synthase sulfur carrier subunit | - |
CF557_RS03980 (CF557_03980) | 831787..832242 | + | 456 | WP_094873407.1 | molybdopterin synthase catalytic subunit MoaE | - |
CF557_RS03985 (CF557_03985) | 832525..832707 | + | 183 | WP_039095731.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
CF557_RS03990 (CF557_03990) | 832737..833147 | + | 411 | WP_039095729.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
CF557_RS03995 (CF557_03995) | 833440..833757 | + | 318 | Protein_764 | KilA-N domain-containing protein | - |
CF557_RS04000 (CF557_04000) | 833846..834289 | - | 444 | WP_018346632.1 | terminus macrodomain insulation protein YfbV | - |
CF557_RS04005 (CF557_04005) | 834480..835685 | + | 1206 | WP_094873410.1 | acetate kinase | - |
CF557_RS04010 (CF557_04010) | 835752..837890 | + | 2139 | WP_094873413.1 | phosphate acetyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6875.01 Da Isoelectric Point: 10.5345
>T266447 WP_039095731.1 NZ_CP114281:832525-832707 [Gallibacterium anatis]
VDSKTLIKMIEEDGWIYRNTTGSHRHYTHPIKKGIVTIPHPKKDIKKGTEHSILKQAGLK
VDSKTLIKMIEEDGWIYRNTTGSHRHYTHPIKKGIVTIPHPKKDIKKGTEHSILKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 15145.22 Da Isoelectric Point: 4.6295
>AT266447 WP_039095729.1 NZ_CP114281:832737-833147 [Gallibacterium anatis]
MLYPIAIEPGDETHAYGVIVPDIPGCFSAGDTLEEAYANVKDAIVGHLELMVEEGLEIPKPTSIENHRHNPDFTDYGMFF
GVVDVDISHLLGKTERINITMPSYLIKRIDDFVATHPQYKNRSHFLASVSADKIMA
MLYPIAIEPGDETHAYGVIVPDIPGCFSAGDTLEEAYANVKDAIVGHLELMVEEGLEIPKPTSIENHRHNPDFTDYGMFF
GVVDVDISHLLGKTERINITMPSYLIKRIDDFVATHPQYKNRSHFLASVSADKIMA
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0A2YI69 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0A2YMS8 |