Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PumA-relB/COG3657-dnstrm_HI1420
Location 754806..755388 Replicon chromosome
Accession NZ_CP114281
Organism Gallibacterium anatis strain ESV200

Toxin (Protein)


Gene name PumA Uniprot ID A0A1A7Q827
Locus tag CF557_RS03600 Protein ID WP_039081967.1
Coordinates 754806..755102 (+) Length 99 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A1A7Q647
Locus tag CF557_RS03605 Protein ID WP_039081966.1
Coordinates 755104..755388 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CF557_RS03565 (CF557_03565) 750611..751801 + 1191 WP_094872976.1 MFS transporter -
CF557_RS03570 (CF557_03570) 751887..752198 - 312 WP_094872979.1 hypothetical protein -
CF557_RS03575 (CF557_03575) 752275..752496 - 222 WP_094872981.1 hypothetical protein -
CF557_RS03580 (CF557_03580) 752555..753385 - 831 Protein_682 IS3 family transposase -
CF557_RS03585 (CF557_03585) 753388..753693 - 306 WP_013744838.1 IS3 family transposase -
CF557_RS03590 (CF557_03590) 753775..754071 + 297 Protein_684 IS3 family transposase -
CF557_RS03595 (CF557_03595) 754267..754419 + 153 WP_179256268.1 hypothetical protein -
CF557_RS03600 (CF557_03600) 754806..755102 + 297 WP_039081967.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
CF557_RS03605 (CF557_03605) 755104..755388 + 285 WP_039081966.1 putative addiction module antidote protein Antitoxin
CF557_RS03610 (CF557_03610) 755571..756260 - 690 WP_094873999.1 MAE_28990/MAE_18760 family HEPN-like nuclease -
CF557_RS03615 (CF557_03615) 756253..757311 - 1059 WP_094873997.1 DUF262 domain-containing protein -
CF557_RS03620 (CF557_03620) 757370..758122 - 753 WP_094873995.1 S24 family peptidase -
CF557_RS03625 (CF557_03625) 758243..758434 + 192 WP_013747125.1 Cro/CI family transcriptional regulator -
CF557_RS03630 (CF557_03630) 758455..758625 + 171 WP_256963614.1 CII family transcriptional regulator -
CF557_RS03635 (CF557_03635) 758767..759105 - 339 WP_080735399.1 IS3 family transposase -
CF557_RS03640 (CF557_03640) 759115..759669 - 555 WP_256963615.1 IS3 family transposase -
CF557_RS03645 (CF557_03645) 759582..760103 - 522 WP_256963613.1 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 752555..787342 34787
- inside IScluster/Tn - - 753811..759105 5294


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(12-90)

Antitoxin

Uncharacterized protein HI1420

(5-91)


Sequences

Toxin        


Download         Length: 99 a.a.        Molecular weight: 10939.90 Da        Isoelectric Point: 10.5231

>T266446 WP_039081967.1 NZ_CP114281:754806-755102 [Gallibacterium anatis]
MIQIKSTEAFDKWLDNLKDLRARAKIQVRIKRLQLGNFGDVKPIGEGLSELRITEGKGYRLYLKNQNGVIVILLCGGDKS
TQKADIEKAKSLAKILGV

Download         Length: 297 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10521.04 Da        Isoelectric Point: 4.6510

>AT266446 WP_039081966.1 NZ_CP114281:755104-755388 [Gallibacterium anatis]
MAEQLKDFDMSEHLRTEEEIQLYLNEILSEGDIDLLLSALGDIAKARNMSQIAREVGVTREGLYKALSGRGNPTFATVFK
VMQALNLNLEVKHA

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1A7Q827

Antitoxin

Source ID Structure
AlphaFold DB A0A1A7Q647

References