Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 4115142..4115695 | Replicon | chromosome |
Accession | NZ_CP114280 | ||
Organism | Dickeya lacustris strain LMG30899 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | - |
Locus tag | O1Q98_RS18670 | Protein ID | WP_125260002.1 |
Coordinates | 4115381..4115695 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | - |
Locus tag | O1Q98_RS18665 | Protein ID | WP_125260001.1 |
Coordinates | 4115142..4115378 (+) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O1Q98_RS18655 (O1Q98_18660) | 4112721..4113565 | + | 845 | WP_278142462.1 | IS5 family transposase | - |
O1Q98_RS18660 (O1Q98_18665) | 4113879..4114823 | + | 945 | WP_125260000.1 | zincin-like metallopeptidase domain-containing protein | - |
O1Q98_RS18665 (O1Q98_18670) | 4115142..4115378 | + | 237 | WP_125260001.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
O1Q98_RS18670 (O1Q98_18675) | 4115381..4115695 | + | 315 | WP_125260002.1 | CcdB family protein | Toxin |
O1Q98_RS18675 (O1Q98_18680) | 4116106..4116816 | + | 711 | WP_240632785.1 | hypothetical protein | - |
O1Q98_RS18680 (O1Q98_18685) | 4117009..4117860 | - | 852 | WP_205744273.1 | hypothetical protein | - |
O1Q98_RS18685 (O1Q98_18690) | 4117854..4119500 | - | 1647 | WP_125260003.1 | AAA family ATPase | - |
O1Q98_RS18690 (O1Q98_18695) | 4119541..4120648 | + | 1108 | Protein_3636 | IS3-like element ISKpn20 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 4098668..4126596 | 27928 | |
- | flank | IS/Tn | - | - | 4112832..4113170 | 338 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11563.53 Da Isoelectric Point: 7.9859
>T266444 WP_125260002.1 NZ_CP114280:4115381-4115695 [Dickeya lacustris]
MQFTVYGNTGKSAIYPLLLDVTSDIIGQLNRRIVIPLLPIEKYPAGRRPDRLVPVVRLTDGKEYAVMTHELASIPVQALG
TVFCDALQYRSQVKAAIDFLIDGF
MQFTVYGNTGKSAIYPLLLDVTSDIIGQLNRRIVIPLLPIEKYPAGRRPDRLVPVVRLTDGKEYAVMTHELASIPVQALG
TVFCDALQYRSQVKAAIDFLIDGF
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|