Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3813953..3814577 | Replicon | chromosome |
Accession | NZ_CP114280 | ||
Organism | Dickeya lacustris strain LMG30899 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | E0SD87 |
Locus tag | O1Q98_RS17255 | Protein ID | WP_009114000.1 |
Coordinates | 3813953..3814156 (-) | Length | 68 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | - |
Locus tag | O1Q98_RS17260 | Protein ID | WP_125258708.1 |
Coordinates | 3814209..3814577 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O1Q98_RS17225 (O1Q98_17230) | 3809579..3809917 | + | 339 | WP_002208627.1 | P-II family nitrogen regulator | - |
O1Q98_RS17230 (O1Q98_17235) | 3809961..3811254 | + | 1294 | Protein_3359 | ammonium transporter AmtB | - |
O1Q98_RS17235 (O1Q98_17240) | 3811395..3812258 | - | 864 | WP_125258705.1 | acyl-CoA thioesterase II | - |
O1Q98_RS17240 (O1Q98_17245) | 3812500..3813057 | + | 558 | WP_125258706.1 | YbaY family lipoprotein | - |
O1Q98_RS17245 (O1Q98_17250) | 3813107..3813436 | - | 330 | WP_125258707.1 | MGMT family protein | - |
O1Q98_RS17255 (O1Q98_17260) | 3813953..3814156 | - | 204 | WP_009114000.1 | HHA domain-containing protein | Toxin |
O1Q98_RS17260 (O1Q98_17265) | 3814209..3814577 | - | 369 | WP_125258708.1 | Hha toxicity modulator TomB | Antitoxin |
O1Q98_RS17265 (O1Q98_17270) | 3815060..3815203 | - | 144 | WP_027712817.1 | type B 50S ribosomal protein L36 | - |
O1Q98_RS17270 (O1Q98_17275) | 3815219..3815470 | - | 252 | WP_125258709.1 | type B 50S ribosomal protein L31 | - |
O1Q98_RS17275 (O1Q98_17280) | 3815628..3818777 | - | 3150 | WP_125258710.1 | efflux RND transporter permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8133.51 Da Isoelectric Point: 8.8500
>T266443 WP_009114000.1 NZ_CP114280:c3814156-3813953 [Dickeya lacustris]
MKKIDYLMRLRKCTTIDTLERVIEKNKYELSNDELEMFYSAADHRLAELTMNKLYDKVPTAVWKYVR
MKKIDYLMRLRKCTTIDTLERVIEKNKYELSNDELEMFYSAADHRLAELTMNKLYDKVPTAVWKYVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14152.93 Da Isoelectric Point: 4.8937
>AT266443 WP_125258708.1 NZ_CP114280:c3814577-3814209 [Dickeya lacustris]
MDEYTPQHYDIAQLRFLCENLHDESIATLGDSSHGWVNDPTSAVNLQLNELIDHIAAFIVTYKIKYPHESGLCERVEKYL
DDTYILFSNYGINDAELQKWQKSKSQLFRMFSEKSVCTVVKT
MDEYTPQHYDIAQLRFLCENLHDESIATLGDSSHGWVNDPTSAVNLQLNELIDHIAAFIVTYKIKYPHESGLCERVEKYL
DDTYILFSNYGINDAELQKWQKSKSQLFRMFSEKSVCTVVKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|