Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yeeU/CbtA-CbeA |
| Location | 2041633..2042380 | Replicon | chromosome |
| Accession | NZ_CP114280 | ||
| Organism | Dickeya lacustris strain LMG30899 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | - |
| Locus tag | O1Q98_RS09260 | Protein ID | WP_102802208.1 |
| Coordinates | 2041633..2041953 (-) | Length | 107 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | O1Q98_RS09265 | Protein ID | WP_240632698.1 |
| Coordinates | 2041979..2042380 (-) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O1Q98_RS09230 (O1Q98_09235) | 2037133..2038182 | - | 1050 | WP_125258126.1 | NAD(P)-dependent alcohol dehydrogenase | - |
| O1Q98_RS09235 (O1Q98_09240) | 2038343..2039260 | + | 918 | WP_125258125.1 | LysR family transcriptional regulator | - |
| O1Q98_RS09240 (O1Q98_09245) | 2039611..2040006 | - | 396 | WP_125258124.1 | DUF6088 family protein | - |
| O1Q98_RS09245 (O1Q98_09250) | 2040043..2040318 | - | 276 | WP_012883161.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| O1Q98_RS09250 (O1Q98_09255) | 2040322..2040570 | - | 249 | WP_012883160.1 | ribbon-helix-helix domain-containing protein | - |
| O1Q98_RS09255 (O1Q98_09260) | 2040681..2041514 | - | 834 | WP_278143540.1 | DUF4942 domain-containing protein | - |
| O1Q98_RS09260 (O1Q98_09265) | 2041633..2041953 | - | 321 | WP_102802208.1 | TA system toxin CbtA family protein | Toxin |
| O1Q98_RS09265 (O1Q98_09270) | 2041979..2042380 | - | 402 | WP_240632698.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| O1Q98_RS09270 (O1Q98_09275) | 2042380..2042853 | - | 474 | WP_278143545.1 | DNA repair protein RadC | - |
| O1Q98_RS09275 (O1Q98_09280) | 2042884..2043705 | - | 822 | WP_278143547.1 | DUF932 domain-containing protein | - |
| O1Q98_RS09280 (O1Q98_09285) | 2043802..2044668 | - | 867 | WP_033576640.1 | GTPase family protein | - |
| O1Q98_RS09285 (O1Q98_09290) | 2044802..2045629 | - | 828 | WP_278143551.1 | ribbon-helix-helix domain-containing protein | - |
| O1Q98_RS09290 (O1Q98_09295) | 2046372..2047001 | + | 630 | WP_278143553.1 | inovirus Gp2 family protein | - |
| O1Q98_RS09295 (O1Q98_09300) | 2047122..2047334 | + | 213 | WP_125258094.1 | AlpA family phage regulatory protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 11955.60 Da Isoelectric Point: 5.0757
>T266440 WP_102802208.1 NZ_CP114280:c2041953-2041633 [Dickeya lacustris]
MQTPSPSPAREASSCLSPVNVWQQLLTYLLDKHYGLTLNDTPFCEEAEIQAHLDAGVSLPDAVNFLVERYELVRIDRSGF
SWQEQKPFLNAVDILRARRATGLLKP
MQTPSPSPAREASSCLSPVNVWQQLLTYLLDKHYGLTLNDTPFCEEAEIQAHLDAGVSLPDAVNFLVERYELVRIDRSGF
SWQEQKPFLNAVDILRARRATGLLKP
Download Length: 321 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14603.74 Da Isoelectric Point: 6.7399
>AT266440 WP_240632698.1 NZ_CP114280:c2042380-2041979 [Dickeya lacustris]
MPFTVIPLTCQEKSTLSLSDALEWGLEHTLKPRFGARLVQEGCHLHFLADRAGVTGTFSATVACHLEHRFPLLVRQLEQK
LVTGELDPRRQQRVTLHDGVLTCEADTLGSAGYVYITIYPTTAATPATAFPSP
MPFTVIPLTCQEKSTLSLSDALEWGLEHTLKPRFGARLVQEGCHLHFLADRAGVTGTFSATVACHLEHRFPLLVRQLEQK
LVTGELDPRRQQRVTLHDGVLTCEADTLGSAGYVYITIYPTTAATPATAFPSP
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|