Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relE-sanaA/DUF6088(antitoxin) |
| Location | 2039611..2040318 | Replicon | chromosome |
| Accession | NZ_CP114280 | ||
| Organism | Dickeya lacustris strain LMG30899 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | D2C2R7 |
| Locus tag | O1Q98_RS09245 | Protein ID | WP_012883161.1 |
| Coordinates | 2040043..2040318 (-) | Length | 92 a.a. |
Antitoxin (Protein)
| Gene name | sanaA | Uniprot ID | - |
| Locus tag | O1Q98_RS09240 | Protein ID | WP_125258124.1 |
| Coordinates | 2039611..2040006 (-) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O1Q98_RS09215 (O1Q98_09220) | 2034814..2035314 | - | 501 | WP_125258128.1 | hypothetical protein | - |
| O1Q98_RS09220 (O1Q98_09225) | 2035539..2036006 | - | 468 | WP_240632702.1 | cyclophilin-like fold protein | - |
| O1Q98_RS09225 (O1Q98_09230) | 2036083..2037111 | - | 1029 | WP_125258127.1 | alpha/beta hydrolase | - |
| O1Q98_RS09230 (O1Q98_09235) | 2037133..2038182 | - | 1050 | WP_125258126.1 | NAD(P)-dependent alcohol dehydrogenase | - |
| O1Q98_RS09235 (O1Q98_09240) | 2038343..2039260 | + | 918 | WP_125258125.1 | LysR family transcriptional regulator | - |
| O1Q98_RS09240 (O1Q98_09245) | 2039611..2040006 | - | 396 | WP_125258124.1 | DUF6088 family protein | Antitoxin |
| O1Q98_RS09245 (O1Q98_09250) | 2040043..2040318 | - | 276 | WP_012883161.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| O1Q98_RS09250 (O1Q98_09255) | 2040322..2040570 | - | 249 | WP_012883160.1 | ribbon-helix-helix domain-containing protein | - |
| O1Q98_RS09255 (O1Q98_09260) | 2040681..2041514 | - | 834 | WP_278143540.1 | DUF4942 domain-containing protein | - |
| O1Q98_RS09260 (O1Q98_09265) | 2041633..2041953 | - | 321 | WP_102802208.1 | TA system toxin CbtA family protein | - |
| O1Q98_RS09265 (O1Q98_09270) | 2041979..2042380 | - | 402 | WP_240632698.1 | type IV toxin-antitoxin system YeeU family antitoxin | - |
| O1Q98_RS09270 (O1Q98_09275) | 2042380..2042853 | - | 474 | WP_278143545.1 | DNA repair protein RadC | - |
| O1Q98_RS09275 (O1Q98_09280) | 2042884..2043705 | - | 822 | WP_278143547.1 | DUF932 domain-containing protein | - |
| O1Q98_RS09280 (O1Q98_09285) | 2043802..2044668 | - | 867 | WP_033576640.1 | GTPase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 11194.47 Da Isoelectric Point: 5.1487
>T266438 WP_012883161.1 NZ_CP114280:c2040318-2040043 [Dickeya lacustris]
MEILWTQKAQDDLERIYRFASQYSRQHADDVLDRLFIGTTELVDHPRIGVSQTRYEPREVRKILFDDYEVHYEIQHNTIY
IVDLWHTREDR
MEILWTQKAQDDLERIYRFASQYSRQHADDVLDRLFIGTTELVDHPRIGVSQTRYEPREVRKILFDDYEVHYEIQHNTIY
IVDLWHTREDR
Download Length: 276 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14297.50 Da Isoelectric Point: 10.3524
>AT266438 WP_125258124.1 NZ_CP114280:c2040006-2039611 [Dickeya lacustris]
MMMRDRIQSRLKSSTRYVFTRDDFKDIGSYAQVGKVLRNLVSEGVLLKVGYGVYTKARQNSITGNIMPSAPGGSSAVIIE
TLECLNVPYRFVGATAAYNSGKSTQIPVSLEIETPLSFKRVLSVGNSKLNA
MMMRDRIQSRLKSSTRYVFTRDDFKDIGSYAQVGKVLRNLVSEGVLLKVGYGVYTKARQNSITGNIMPSAPGGSSAVIIE
TLECLNVPYRFVGATAAYNSGKSTQIPVSLEIETPLSFKRVLSVGNSKLNA
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|