Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 1972125..1972651 | Replicon | chromosome |
Accession | NZ_CP114280 | ||
Organism | Dickeya lacustris strain LMG30899 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | - |
Locus tag | O1Q98_RS08920 | Protein ID | WP_125258181.1 |
Coordinates | 1972346..1972651 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | E0SK21 |
Locus tag | O1Q98_RS08915 | Protein ID | WP_012773205.1 |
Coordinates | 1972125..1972343 (+) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O1Q98_RS08885 (O1Q98_08890) | 1967266..1968567 | + | 1302 | WP_125258185.1 | anaerobic C4-dicarboxylate transporter | - |
O1Q98_RS08890 (O1Q98_08895) | 1968704..1969048 | + | 345 | WP_125258184.1 | divalent cation tolerance protein CutA | - |
O1Q98_RS08895 (O1Q98_08900) | 1969024..1970769 | + | 1746 | WP_125258183.1 | protein-disulfide reductase DsbD | - |
O1Q98_RS08900 (O1Q98_08905) | 1970889..1971464 | + | 576 | WP_125258182.1 | transcriptional regulator | - |
O1Q98_RS08910 (O1Q98_08915) | 1971804..1972032 | + | 229 | Protein_1742 | molybdopterin-guanine dinucleotide biosynthesis protein MobC | - |
O1Q98_RS08915 (O1Q98_08920) | 1972125..1972343 | + | 219 | WP_012773205.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
O1Q98_RS08920 (O1Q98_08925) | 1972346..1972651 | + | 306 | WP_125258181.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
O1Q98_RS08925 (O1Q98_08930) | 1972805..1975177 | - | 2373 | WP_125258180.1 | AAA family ATPase | - |
O1Q98_RS08930 (O1Q98_08935) | 1975170..1975889 | - | 720 | WP_125258179.1 | hypothetical protein | - |
O1Q98_RS08935 (O1Q98_08940) | 1975886..1977253 | - | 1368 | WP_125258178.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11651.49 Da Isoelectric Point: 4.4056
>T266437 WP_125258181.1 NZ_CP114280:1972346-1972651 [Dickeya lacustris]
MQFIVYEYKRASHYTMLVDVQSDIVETPKRRMVIPLIESHRLSEKVNKTLFPLISIDGEDYRLMTTELSSVPVEVIGEVI
ADLGDYADEIKDAINLMFWGI
MQFIVYEYKRASHYTMLVDVQSDIVETPKRRMVIPLIESHRLSEKVNKTLFPLISIDGEDYRLMTTELSSVPVEVIGEVI
ADLGDYADEIKDAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|