Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 1830251..1830929 | Replicon | chromosome |
Accession | NZ_CP114280 | ||
Organism | Dickeya lacustris strain LMG30899 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | O1Q98_RS08230 | Protein ID | WP_125258301.1 |
Coordinates | 1830251..1830682 (-) | Length | 144 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | - |
Locus tag | O1Q98_RS08235 | Protein ID | WP_125258300.1 |
Coordinates | 1830663..1830929 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O1Q98_RS08210 (O1Q98_08215) | 1826186..1826902 | - | 717 | WP_125258305.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
O1Q98_RS08215 (O1Q98_08220) | 1826991..1827890 | - | 900 | WP_125258304.1 | site-specific tyrosine recombinase XerD | - |
O1Q98_RS08220 (O1Q98_08225) | 1828152..1829477 | + | 1326 | WP_125258303.1 | MFS transporter | - |
O1Q98_RS08225 (O1Q98_08230) | 1829586..1830104 | + | 519 | WP_125258302.1 | flavodoxin FldB | - |
O1Q98_RS08230 (O1Q98_08235) | 1830251..1830682 | - | 432 | WP_125258301.1 | protein YgfX | Toxin |
O1Q98_RS08235 (O1Q98_08240) | 1830663..1830929 | - | 267 | WP_125258300.1 | FAD assembly factor SdhE | Antitoxin |
O1Q98_RS08240 (O1Q98_08245) | 1831244..1832224 | + | 981 | WP_125258299.1 | tRNA-modifying protein YgfZ | - |
O1Q98_RS08245 (O1Q98_08250) | 1832305..1832955 | - | 651 | WP_125258298.1 | hemolysin III family protein | - |
O1Q98_RS08250 (O1Q98_08255) | 1833162..1833770 | + | 609 | WP_125258297.1 | HD domain-containing protein | - |
O1Q98_RS08255 (O1Q98_08260) | 1833895..1834536 | - | 642 | WP_125258296.1 | LysE family translocator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 144 a.a. Molecular weight: 17014.09 Da Isoelectric Point: 11.8614
>T266436 WP_125258301.1 NZ_CP114280:c1830682-1830251 [Dickeya lacustris]
VAQWQCDLRVSWRMQLFSLMMHGFLVLMILLAPWPDGYAPLWLGLLTLVVFGFVRSQRVIKLRQGEIALHDENRLRWQQR
DWLMVRRPWMLRSGILLSLRAVNGKEQQRLWLASDSMGSEEWRRLCQLLRQQPLAGIQSSRHH
VAQWQCDLRVSWRMQLFSLMMHGFLVLMILLAPWPDGYAPLWLGLLTLVVFGFVRSQRVIKLRQGEIALHDENRLRWQQR
DWLMVRRPWMLRSGILLSLRAVNGKEQQRLWLASDSMGSEEWRRLCQLLRQQPLAGIQSSRHH
Download Length: 432 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|