Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
| Location | 1722896..1723563 | Replicon | chromosome |
| Accession | NZ_CP114280 | ||
| Organism | Dickeya lacustris strain LMG30899 | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | - |
| Locus tag | O1Q98_RS07780 | Protein ID | WP_125258372.1 |
| Coordinates | 1723234..1723563 (+) | Length | 110 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | - |
| Locus tag | O1Q98_RS07775 | Protein ID | WP_125258373.1 |
| Coordinates | 1722896..1723213 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O1Q98_RS07730 (O1Q98_07725) | 1718029..1718862 | + | 834 | WP_125258382.1 | DUF932 domain-containing protein | - |
| O1Q98_RS07735 (O1Q98_07730) | 1719071..1719781 | + | 711 | WP_125258381.1 | DeoR family transcriptional regulator | - |
| O1Q98_RS07740 (O1Q98_07735) | 1719807..1720343 | + | 537 | WP_125258380.1 | DUF4339 domain-containing protein | - |
| O1Q98_RS07745 (O1Q98_07740) | 1720385..1720822 | + | 438 | WP_125258379.1 | hypothetical protein | - |
| O1Q98_RS07750 (O1Q98_07745) | 1720889..1721299 | + | 411 | WP_125258378.1 | hypothetical protein | - |
| O1Q98_RS07755 (O1Q98_07750) | 1721377..1721613 | + | 237 | WP_125258377.1 | DUF905 domain-containing protein | - |
| O1Q98_RS07760 (O1Q98_07755) | 1721699..1722157 | + | 459 | WP_125258376.1 | antirestriction protein | - |
| O1Q98_RS07765 (O1Q98_07760) | 1722166..1722648 | + | 483 | WP_125258375.1 | DNA repair protein RadC | - |
| O1Q98_RS07770 (O1Q98_07765) | 1722657..1722878 | + | 222 | WP_125258374.1 | DUF987 domain-containing protein | - |
| O1Q98_RS07775 (O1Q98_07770) | 1722896..1723213 | + | 318 | WP_125258373.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| O1Q98_RS07780 (O1Q98_07775) | 1723234..1723563 | + | 330 | WP_125258372.1 | TA system toxin CbtA family protein | Toxin |
| O1Q98_RS07785 (O1Q98_07780) | 1724265..1725038 | - | 774 | WP_125258394.1 | ABC transporter ATP-binding protein | - |
| O1Q98_RS07790 (O1Q98_07785) | 1725081..1725974 | - | 894 | WP_240632713.1 | ABC transporter ATP-binding protein | - |
| O1Q98_RS07795 (O1Q98_07790) | 1725946..1726851 | - | 906 | WP_125258371.1 | ABC transporter permease | - |
| O1Q98_RS07800 (O1Q98_07795) | 1726848..1727906 | - | 1059 | WP_125258370.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12299.29 Da Isoelectric Point: 10.1794
>T266435 WP_125258372.1 NZ_CP114280:1723234-1723563 [Dickeya lacustris]
MKNLPATISRAAKPCLSPVSVWQMLLTRLLEQHYGLTLNDTPFSDKTVIQEHINAGVSLSDAVNFLVEKYGLVRIDRKGF
SWQEQTPYISVVDILRARRSTGLLKTNVK
MKNLPATISRAAKPCLSPVSVWQMLLTRLLEQHYGLTLNDTPFSDKTVIQEHINAGVSLSDAVNFLVEKYGLVRIDRKGF
SWQEQTPYISVVDILRARRSTGLLKTNVK
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|