Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1140084..1140718 | Replicon | chromosome |
Accession | NZ_CP114280 | ||
Organism | Dickeya lacustris strain LMG30899 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | O1Q98_RS05115 | Protein ID | WP_125258112.1 |
Coordinates | 1140084..1140488 (-) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | O1Q98_RS05120 | Protein ID | WP_125258111.1 |
Coordinates | 1140488..1140718 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O1Q98_RS05095 (O1Q98_05090) | 1135577..1136002 | - | 426 | WP_125258115.1 | glutaredoxin-dependent arsenate reductase | - |
O1Q98_RS05100 (O1Q98_05095) | 1136015..1137304 | - | 1290 | WP_125258114.1 | arsenic transporter | - |
O1Q98_RS05105 (O1Q98_05100) | 1137751..1138686 | - | 936 | WP_125258113.1 | LysR family transcriptional regulator | - |
O1Q98_RS05110 (O1Q98_05105) | 1138772..1139713 | + | 942 | WP_125258122.1 | carbon-nitrogen hydrolase family protein | - |
O1Q98_RS05115 (O1Q98_05110) | 1140084..1140488 | - | 405 | WP_125258112.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
O1Q98_RS05120 (O1Q98_05115) | 1140488..1140718 | - | 231 | WP_125258111.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
O1Q98_RS05125 (O1Q98_05120) | 1140812..1141645 | - | 834 | WP_278143107.1 | DUF4942 domain-containing protein | - |
O1Q98_RS05130 (O1Q98_05125) | 1141764..1142084 | - | 321 | WP_125258109.1 | TA system toxin CbtA family protein | - |
O1Q98_RS05135 (O1Q98_05130) | 1142110..1142510 | - | 401 | Protein_1019 | type IV toxin-antitoxin system YeeU family antitoxin | - |
O1Q98_RS05140 (O1Q98_05135) | 1142510..1142983 | - | 474 | WP_278143110.1 | DNA repair protein RadC | - |
O1Q98_RS05145 (O1Q98_05140) | 1143014..1143835 | - | 822 | WP_125258105.1 | DUF932 domain-containing protein | - |
O1Q98_RS05150 (O1Q98_05145) | 1143933..1144799 | - | 867 | WP_125258104.1 | GTPase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15024.23 Da Isoelectric Point: 7.9982
>T266434 WP_125258112.1 NZ_CP114280:c1140488-1140084 [Dickeya lacustris]
MLKYLLDTNICIYTIKNKPQEVREAFQRYYGQFAISSITLMELIYGAEKSANPEKNLAVIEGFSARLDIQSYGFDAAVHT
GQIRAELAKQGTPIGPYDAMLAGHARSAGLILITNNVREFERVPGLRVENWVSR
MLKYLLDTNICIYTIKNKPQEVREAFQRYYGQFAISSITLMELIYGAEKSANPEKNLAVIEGFSARLDIQSYGFDAAVHT
GQIRAELAKQGTPIGPYDAMLAGHARSAGLILITNNVREFERVPGLRVENWVSR
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|