Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 3022268..3022932 | Replicon | chromosome |
| Accession | NZ_CP114278 | ||
| Organism | Brevundimonas vesicularis strain Br4 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | O2K97_RS15050 | Protein ID | WP_269219892.1 |
| Coordinates | 3022498..3022932 (+) | Length | 145 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A0S9NKB5 |
| Locus tag | O2K97_RS15045 | Protein ID | WP_017506756.1 |
| Coordinates | 3022268..3022501 (+) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O2K97_RS15025 | 3017904..3018749 | - | 846 | WP_269219889.1 | tol-pal system protein | - |
| O2K97_RS15030 | 3018791..3019930 | - | 1140 | WP_269219890.1 | DUF3667 domain-containing protein | - |
| O2K97_RS15035 | 3020058..3020621 | - | 564 | WP_039246161.1 | peptidoglycan-associated lipoprotein Pal | - |
| O2K97_RS15040 | 3020762..3022126 | - | 1365 | WP_269219891.1 | Tol-Pal system beta propeller repeat protein TolB | - |
| O2K97_RS15045 | 3022268..3022501 | + | 234 | WP_017506756.1 | hypothetical protein | Antitoxin |
| O2K97_RS15050 | 3022498..3022932 | + | 435 | WP_269219892.1 | VapC toxin family PIN domain ribonuclease | Toxin |
| O2K97_RS15055 | 3022936..3023814 | - | 879 | WP_269219893.1 | cell envelope integrity protein TolA | - |
| O2K97_RS15060 | 3023820..3024272 | - | 453 | WP_205681722.1 | protein TolR | - |
| O2K97_RS15065 | 3024276..3025028 | - | 753 | WP_269219894.1 | protein TolQ | - |
| O2K97_RS15070 | 3025167..3025601 | - | 435 | WP_269219895.1 | hypothetical protein | - |
| O2K97_RS15075 | 3025628..3026086 | - | 459 | WP_269221149.1 | tol-pal system-associated acyl-CoA thioesterase | - |
| O2K97_RS15080 | 3026092..3026955 | - | 864 | WP_269219896.1 | hypothetical protein | - |
| O2K97_RS15085 | 3026952..3027320 | - | 369 | WP_017506434.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 145 a.a. Molecular weight: 15323.57 Da Isoelectric Point: 6.6004
>T266433 WP_269219892.1 NZ_CP114278:3022498-3022932 [Brevundimonas vesicularis]
MIALLDVSVLIALIDPAHTEHLTAHAWFANEHQAGWATCPLTENGALRILSNPKYPNSPGAPAQVLPALHSLLSQPGHAF
WPDDISLLGDRLIAQDRLLTSGQLTDTYLLALAVSNGGRLATFDRRLAPDAVKGGKAALHLITA
MIALLDVSVLIALIDPAHTEHLTAHAWFANEHQAGWATCPLTENGALRILSNPKYPNSPGAPAQVLPALHSLLSQPGHAF
WPDDISLLGDRLIAQDRLLTSGQLTDTYLLALAVSNGGRLATFDRRLAPDAVKGGKAALHLITA
Download Length: 435 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|