Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/CC2985(antitoxin) |
Location | 2915404..2915986 | Replicon | chromosome |
Accession | NZ_CP114278 | ||
Organism | Brevundimonas vesicularis strain Br4 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | O2K97_RS14460 | Protein ID | WP_269219805.1 |
Coordinates | 2915669..2915986 (+) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | - |
Locus tag | O2K97_RS14455 | Protein ID | WP_269219804.1 |
Coordinates | 2915404..2915661 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O2K97_RS14430 | 2910459..2910719 | + | 261 | WP_269219799.1 | Txe/YoeB family addiction module toxin | - |
O2K97_RS14435 | 2910716..2911435 | + | 720 | WP_269219800.1 | 16S rRNA (uracil(1498)-N(3))-methyltransferase | - |
O2K97_RS14440 | 2911571..2912932 | + | 1362 | WP_269219801.1 | glutamate--cysteine ligase | - |
O2K97_RS14445 | 2912929..2913666 | - | 738 | WP_269219802.1 | hypothetical protein | - |
O2K97_RS14450 | 2913778..2915349 | + | 1572 | WP_269219803.1 | ATP-binding protein | - |
O2K97_RS14455 | 2915404..2915661 | + | 258 | WP_269219804.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
O2K97_RS14460 | 2915669..2915986 | + | 318 | WP_269219805.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
O2K97_RS14465 | 2915983..2916732 | + | 750 | WP_269219806.1 | DUF72 domain-containing protein | - |
O2K97_RS14470 | 2916808..2917869 | + | 1062 | WP_269219807.1 | NAD(P)-dependent alcohol dehydrogenase | - |
O2K97_RS14475 | 2918014..2918739 | + | 726 | WP_066549787.1 | acetoacetyl-CoA reductase | - |
O2K97_RS14480 | 2918840..2919556 | + | 717 | WP_269221144.1 | DUF4908 domain-containing protein | - |
O2K97_RS14485 | 2919661..2920383 | - | 723 | WP_269219808.1 | hydroxyacylglutathione hydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 11661.27 Da Isoelectric Point: 9.3193
>T266432 WP_269219805.1 NZ_CP114278:2915669-2915986 [Brevundimonas vesicularis]
VSARYSNAAKRDLIAIYLDGAAKFGSRQAAAYTTGLGATVRMISDYPLSSRLRTELDLPVRVRTYKAHVIIYVIEEGGVL
VLRFRHGHEDWQSDPLGGDLDKDKP
VSARYSNAAKRDLIAIYLDGAAKFGSRQAAAYTTGLGATVRMISDYPLSSRLRTELDLPVRVRTYKAHVIIYVIEEGGVL
VLRFRHGHEDWQSDPLGGDLDKDKP
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|