Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 6223..6845 | Replicon | plasmid pTR11_2 |
| Accession | NZ_CP114258 | ||
| Organism | Acinetobacter sp. TR11 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A9E9L1H0 |
| Locus tag | O1450_RS16330 | Protein ID | WP_075041255.1 |
| Coordinates | 6223..6618 (-) | Length | 132 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A3A8E7V1 |
| Locus tag | O1450_RS16335 | Protein ID | WP_012268402.1 |
| Coordinates | 6615..6845 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O1450_RS16305 (O1450_16305) | 1532..1675 | + | 144 | WP_001125248.1 | hypothetical protein | - |
| O1450_RS16310 (O1450_16310) | 1899..3086 | - | 1188 | WP_004856455.1 | tetracycline efflux MFS transporter Tet(39) | - |
| O1450_RS16315 (O1450_16315) | 3152..3793 | + | 642 | WP_004787586.1 | TetR/AcrR family transcriptional regulator C-terminal domain-containing protein | - |
| O1450_RS16320 (O1450_16320) | 4320..4988 | - | 669 | WP_151781635.1 | DUF4276 family protein | - |
| O1450_RS16325 (O1450_16325) | 4982..6076 | - | 1095 | WP_151781636.1 | AAA family ATPase | - |
| O1450_RS16330 (O1450_16330) | 6223..6618 | - | 396 | WP_075041255.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| O1450_RS16335 (O1450_16335) | 6615..6845 | - | 231 | WP_012268402.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| O1450_RS16340 (O1450_16340) | 7423..7689 | - | 267 | WP_151776320.1 | hypothetical protein | - |
| O1450_RS16345 (O1450_16345) | 7852..8073 | - | 222 | WP_086335755.1 | hypothetical protein | - |
| O1450_RS16350 (O1450_16350) | 8070..8426 | - | 357 | WP_151781637.1 | hypothetical protein | - |
| O1450_RS16355 (O1450_16355) | 8466..9347 | - | 882 | WP_269230492.1 | MobA/MobL family protein | - |
| O1450_RS16360 (O1450_16360) | 9568..10290 | + | 723 | WP_269230493.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | tet(39) | - | 1..10958 | 10958 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14919.24 Da Isoelectric Point: 6.2253
>T266427 WP_075041255.1 NZ_CP114258:c6618-6223 [Acinetobacter sp. TR11]
MIYLLDTNICIYVINNKPQHVFERFKQYQLGQLAISSITASELAFGVEKSGSERNKQALNKFLSPLEILPYDEQAIWHYA
KLRQDLQSIGKPIGSLDMLIAAHALALDVVLVTNNTKEFERIDGLKLENWV
MIYLLDTNICIYVINNKPQHVFERFKQYQLGQLAISSITASELAFGVEKSGSERNKQALNKFLSPLEILPYDEQAIWHYA
KLRQDLQSIGKPIGSLDMLIAAHALALDVVLVTNNTKEFERIDGLKLENWV
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|