Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 6223..6845 Replicon plasmid pTR11_2
Accession NZ_CP114258
Organism Acinetobacter sp. TR11

Toxin (Protein)


Gene name vapC Uniprot ID A0A9E9L1H0
Locus tag O1450_RS16330 Protein ID WP_075041255.1
Coordinates 6223..6618 (-) Length 132 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A3A8E7V1
Locus tag O1450_RS16335 Protein ID WP_012268402.1
Coordinates 6615..6845 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O1450_RS16305 (O1450_16305) 1532..1675 + 144 WP_001125248.1 hypothetical protein -
O1450_RS16310 (O1450_16310) 1899..3086 - 1188 WP_004856455.1 tetracycline efflux MFS transporter Tet(39) -
O1450_RS16315 (O1450_16315) 3152..3793 + 642 WP_004787586.1 TetR/AcrR family transcriptional regulator C-terminal domain-containing protein -
O1450_RS16320 (O1450_16320) 4320..4988 - 669 WP_151781635.1 DUF4276 family protein -
O1450_RS16325 (O1450_16325) 4982..6076 - 1095 WP_151781636.1 AAA family ATPase -
O1450_RS16330 (O1450_16330) 6223..6618 - 396 WP_075041255.1 type II toxin-antitoxin system VapC family toxin Toxin
O1450_RS16335 (O1450_16335) 6615..6845 - 231 WP_012268402.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
O1450_RS16340 (O1450_16340) 7423..7689 - 267 WP_151776320.1 hypothetical protein -
O1450_RS16345 (O1450_16345) 7852..8073 - 222 WP_086335755.1 hypothetical protein -
O1450_RS16350 (O1450_16350) 8070..8426 - 357 WP_151781637.1 hypothetical protein -
O1450_RS16355 (O1450_16355) 8466..9347 - 882 WP_269230492.1 MobA/MobL family protein -
O1450_RS16360 (O1450_16360) 9568..10290 + 723 WP_269230493.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid tet(39) - 1..10958 10958


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(3-124)

Antitoxin

SpoVT-AbrB domain

(7-37)


Sequences

Toxin        


Download         Length: 132 a.a.        Molecular weight: 14919.24 Da        Isoelectric Point: 6.2253

>T266427 WP_075041255.1 NZ_CP114258:c6618-6223 [Acinetobacter sp. TR11]
MIYLLDTNICIYVINNKPQHVFERFKQYQLGQLAISSITASELAFGVEKSGSERNKQALNKFLSPLEILPYDEQAIWHYA
KLRQDLQSIGKPIGSLDMLIAAHALALDVVLVTNNTKEFERIDGLKLENWV

Download         Length: 396 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8765.04 Da        Isoelectric Point: 4.7708

>AT266427 WP_012268402.1 NZ_CP114258:c6845-6615 [Acinetobacter sp. TR11]
MEIAKVFQTGRSQAVRLPKAFRFNGTEVAIKSFGRGVLLMPIDNPWDVMLEAINEFEVGFQLERADQGEQFREEFK

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A3A8E7V1

References