Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 5425313..5425877 | Replicon | chromosome |
Accession | NZ_CP114205 | ||
Organism | Streptomyces tubercidicus strain DSM 40261 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | STRTU_RS23555 | Protein ID | WP_159745908.1 |
Coordinates | 5425530..5425877 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | STRTU_RS23550 | Protein ID | WP_159745906.1 |
Coordinates | 5425313..5425543 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
STRTU_RS23535 (STRTU_004706) | 5420339..5421292 | + | 954 | WP_159745900.1 | LysR family transcriptional regulator | - |
STRTU_RS23540 (STRTU_004707) | 5421381..5422526 | + | 1146 | WP_159745902.1 | allantoicase | - |
STRTU_RS23545 (STRTU_004708) | 5422593..5425187 | - | 2595 | WP_159745904.1 | aminopeptidase N | - |
STRTU_RS23550 (STRTU_004709) | 5425313..5425543 | + | 231 | WP_159745906.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
STRTU_RS23555 (STRTU_004710) | 5425530..5425877 | + | 348 | WP_159745908.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
STRTU_RS23560 (STRTU_004711) | 5425985..5426563 | + | 579 | WP_159745910.1 | DUF1203 domain-containing protein | - |
STRTU_RS23565 (STRTU_004712) | 5426630..5427661 | - | 1032 | WP_159745912.1 | aspartate-semialdehyde dehydrogenase | - |
STRTU_RS23570 (STRTU_004713) | 5428066..5429805 | + | 1740 | WP_159745914.1 | TIGR03767 family metallophosphoesterase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12693.64 Da Isoelectric Point: 10.7701
>T266425 WP_159745908.1 NZ_CP114205:5425530-5425877 [Streptomyces tubercidicus]
MRRGDIYMVDLEPVRGSEASKVRPAVIVSNNGANQSVESNRRGVVTVVPLTSNTSRVLSFQVFLGADECRLPKDSKAQCE
QLRAIALERVLHKVGSVPRQRMAEVDAALRRHLAL
MRRGDIYMVDLEPVRGSEASKVRPAVIVSNNGANQSVESNRRGVVTVVPLTSNTSRVLSFQVFLGADECRLPKDSKAQCE
QLRAIALERVLHKVGSVPRQRMAEVDAALRRHLAL
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|