Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-MazE |
| Location | 3263314..3263987 | Replicon | chromosome |
| Accession | NZ_CP114201 | ||
| Organism | Delftia acidovorans strain BIM B-1761 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | O1V13_RS14735 | Protein ID | WP_269199065.1 |
| Coordinates | 3263577..3263987 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | O1V13_RS14730 | Protein ID | WP_269199064.1 |
| Coordinates | 3263314..3263580 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O1V13_RS14705 (O1V13_14705) | 3258409..3259689 | - | 1281 | WP_013802434.1 | TRAP transporter large permease subunit | - |
| O1V13_RS14710 (O1V13_14710) | 3259702..3260208 | - | 507 | WP_012205588.1 | TRAP transporter small permease | - |
| O1V13_RS14715 (O1V13_14715) | 3260227..3260814 | - | 588 | WP_269199063.1 | gluconokinase | - |
| O1V13_RS14720 (O1V13_14720) | 3260971..3262065 | + | 1095 | WP_012205586.1 | LacI family DNA-binding transcriptional regulator | - |
| O1V13_RS14725 (O1V13_14725) | 3262102..3263073 | - | 972 | WP_012205585.1 | chemotaxis protein | - |
| O1V13_RS14730 (O1V13_14730) | 3263314..3263580 | + | 267 | WP_269199064.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| O1V13_RS14735 (O1V13_14735) | 3263577..3263987 | + | 411 | WP_269199065.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| O1V13_RS14740 (O1V13_14740) | 3264021..3266069 | - | 2049 | WP_063326165.1 | acetyl-CoA carboxylase biotin carboxylase subunit | - |
| O1V13_RS14745 (O1V13_14745) | 3266281..3267813 | - | 1533 | WP_269199066.1 | acyl-CoA carboxylase subunit beta | - |
| O1V13_RS14750 (O1V13_14750) | 3267870..3268931 | - | 1062 | WP_269199067.1 | methylmalonyl Co-A mutase-associated GTPase MeaB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3252432..3263987 | 11555 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15169.50 Da Isoelectric Point: 7.3849
>T266422 WP_269199065.1 NZ_CP114201:3263577-3263987 [Delftia acidovorans]
MMLYMLDTNAASEAIRGNPLFDARLQALAPGQWCVGAVTCSELRYGIARRPEAVRLARIVEAFLHITAILPWDARAANQH
GQLRAYLRAQGSPIGDFDEMIAAHALALDAILVTDNVRHFERIPGLRIENWLRQGH
MMLYMLDTNAASEAIRGNPLFDARLQALAPGQWCVGAVTCSELRYGIARRPEAVRLARIVEAFLHITAILPWDARAANQH
GQLRAYLRAQGSPIGDFDEMIAAHALALDAILVTDNVRHFERIPGLRIENWLRQGH
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|