Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Fic(toxin) |
Location | 5555129..5555703 | Replicon | chromosome |
Accession | NZ_CP114200 | ||
Organism | Streptomyces sp. 71268 |
Toxin (Protein)
Gene name | doc | Uniprot ID | - |
Locus tag | OYE22_RS21925 | Protein ID | WP_187062828.1 |
Coordinates | 5555326..5555703 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | - |
Locus tag | OYE22_RS21920 | Protein ID | WP_277321996.1 |
Coordinates | 5555129..5555326 (+) | Length | 66 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OYE22_RS21900 (OYE22_21930) | 5550324..5551229 | + | 906 | WP_277321993.1 | LysR family transcriptional regulator | - |
OYE22_RS21905 (OYE22_21935) | 5551369..5551941 | + | 573 | WP_277321994.1 | cysteine dioxygenase family protein | - |
OYE22_RS21910 (OYE22_21940) | 5552127..5553143 | + | 1017 | WP_277324257.1 | putative sulfate exporter family transporter | - |
OYE22_RS21915 (OYE22_21945) | 5553432..5555096 | + | 1665 | WP_277321995.1 | MFS transporter | - |
OYE22_RS21920 (OYE22_21950) | 5555129..5555326 | + | 198 | WP_277321996.1 | Arc family DNA-binding protein | Antitoxin |
OYE22_RS21925 (OYE22_21955) | 5555326..5555703 | + | 378 | WP_187062828.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
OYE22_RS21930 (OYE22_21960) | 5555847..5557631 | + | 1785 | WP_176161877.1 | DEAD/DEAH box helicase | - |
OYE22_RS21935 (OYE22_21965) | 5558054..5558692 | + | 639 | WP_176161876.1 | helix-turn-helix domain-containing protein | - |
OYE22_RS21940 (OYE22_21970) | 5558910..5559689 | + | 780 | WP_277321997.1 | S16 family serine protease | - |
OYE22_RS21945 (OYE22_21975) | 5560023..5560643 | - | 621 | Protein_4320 | winged helix-turn-helix domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13850.80 Da Isoelectric Point: 4.6873
>T266419 WP_187062828.1 NZ_CP114200:5555326-5555703 [Streptomyces sp. 71268]
MKFLDLPQLLGLAQRLGESEVRDYGLLESALARPQASVFGQDAYPDVWQKAAALMESLARNHAMVDGNKRLAWYATWVFL
HVNGHPLVEGFDVDEAERFVLNVAQGELDVPKIAELLPRFAASSA
MKFLDLPQLLGLAQRLGESEVRDYGLLESALARPQASVFGQDAYPDVWQKAAALMESLARNHAMVDGNKRLAWYATWVFL
HVNGHPLVEGFDVDEAERFVLNVAQGELDVPKIAELLPRFAASSA
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|